ANSR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ANSR - HTH-type transcriptional regulator AnsR

UniProt:	Q07683	Sequences: MNLDRLTELRKKKNWSLQYTADLLGIAKSTYAGYESGYRRPSLEALAMLADLFDTTCDELLGREKQKQTAPQAIELATWSSLDFTISVDGQPLSEDEIIQLITFIRTKRKVQEELS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (107)
Sequences:	1355 (1208)
Seq/√Len:	116.8

ECOLI - DICA
BACSU - ANSR YOBD YQAE YONR SLRR RGHRB SINR RGHR XRE IMMR YQAF YGZD YAZB
HALSA - O51961 Q9HRZ8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_T	31_Y	3.337	1.00
18_Q	22_D	2.926	1.00
18_Q	28_K	2.915	1.00
51_D	63_R	2.672	1.00
2_N	6_L	2.649	1.00
15_W	52_L	2.613	1.00
10_R	35_E	2.243	1.00
3_L	37_G	2.210	1.00
23_L	52_L	2.122	1.00
27_A	30_T	2.069	1.00
29_S	33_G	2.055	1.00
12_K	67_K	2.048	1.00
26_I	31_Y	2.030	1.00
9_L	53_F	2.002	1.00
57_C	61_L	1.934	1.00
20_T	53_F	1.784	1.00
33_G	38_Y	1.783	1.00
94_S	97_E	1.762	1.00
40_R	43_L	1.760	1.00
100_Q	107_T	1.671	1.00
104_F	107_T	1.654	1.00
33_G	39_R	1.631	1.00
29_S	32_A	1.620	1.00
50_A	63_R	1.425	1.00
58_D	63_R	1.423	1.00
104_F	108_K	1.414	1.00
30_T	33_G	1.399	1.00
93_L	98_I	1.385	1.00
64_E	67_K	1.369	1.00
28_K	32_A	1.369	1.00
27_A	33_G	1.368	1.00
5_R	59_E	1.360	1.00
101_L	105_I	1.358	1.00
20_T	49_L	1.297	1.00
6_L	31_Y	1.291	1.00
43_L	46_L	1.262	0.99
34_Y	45_A	1.239	0.99
19_Y	22_D	1.217	0.99
100_Q	104_F	1.188	0.99
97_E	100_Q	1.177	0.99
42_S	45_A	1.166	0.99
4_D	37_G	1.146	0.99
87_S	90_G	1.144	0.99
34_Y	41_P	1.112	0.99
100_Q	108_K	1.099	0.98
5_R	63_R	1.098	0.98
103_T	107_T	1.093	0.98
17_L	28_K	1.086	0.98
33_G	36_S	1.081	0.98
2_N	43_L	1.060	0.98
32_A	36_S	1.046	0.98
90_G	93_L	1.042	0.98
46_L	61_L	1.039	0.98
101_L	108_K	1.026	0.98
15_W	23_L	1.013	0.97
24_L	49_L	1.010	0.97
17_L	31_Y	1.001	0.97
40_R	45_A	0.993	0.97
34_Y	39_R	0.980	0.97
26_I	30_T	0.971	0.97
55_T	59_E	0.971	0.97
45_A	48_M	0.948	0.96
97_E	104_F	0.947	0.96
102_I	106_R	0.931	0.96
5_R	65_K	0.925	0.95
19_Y	23_L	0.924	0.95
2_N	60_L	0.908	0.95
28_K	36_S	0.906	0.95
75_E	78_T	0.905	0.95
17_L	21_A	0.873	0.94
46_L	57_C	0.873	0.94
6_L	53_F	0.870	0.94
5_R	62_G	0.867	0.94
21_A	31_Y	0.826	0.92
32_A	41_P	0.815	0.91
16_S	19_Y	0.804	0.91
27_A	32_A	0.804	0.91
93_L	105_I	0.803	0.91
5_R	8_E	0.792	0.90
15_W	19_Y	0.775	0.89
85_T	88_V	0.760	0.88
94_S	100_Q	0.760	0.88
28_K	38_Y	0.755	0.88
30_T	34_Y	0.755	0.88
28_K	33_G	0.733	0.86
41_P	58_D	0.722	0.86
85_T	90_G	0.720	0.85
24_L	53_F	0.719	0.85
91_Q	98_I	0.713	0.85
87_S	105_I	0.711	0.85
2_N	53_F	0.706	0.84
82_L	91_Q	0.703	0.84
46_L	58_D	0.702	0.84
50_A	57_C	0.702	0.84
31_Y	34_Y	0.695	0.83
91_Q	94_S	0.693	0.83
21_A	29_S	0.691	0.83
34_Y	42_S	0.683	0.82
88_V	100_Q	0.679	0.82
8_E	12_K	0.674	0.81
66_Q	69_T	0.671	0.81
84_F	88_V	0.670	0.81
32_A	42_S	0.669	0.81
2_N	46_L	0.663	0.80
80_S	84_F	0.656	0.80
95_E	99_I	0.651	0.79
29_S	39_R	0.651	0.79
26_I	34_Y	0.651	0.79
41_P	45_A	0.649	0.79
105_I	108_K	0.649	0.79
83_D	89_D	0.644	0.78
13_K	23_L	0.642	0.78
25_G	48_M	0.639	0.78
28_K	31_Y	0.638	0.78
26_I	29_S	0.638	0.78
76_L	97_E	0.637	0.78
9_L	55_T	0.632	0.77
21_A	28_K	0.628	0.77
92_P	107_T	0.618	0.76
97_E	108_K	0.613	0.75
81_S	84_F	0.613	0.75
39_R	42_S	0.609	0.75
100_Q	103_T	0.608	0.74
34_Y	43_L	0.605	0.74
15_W	20_T	0.601	0.74
2_N	41_P	0.600	0.73
20_T	52_L	0.599	0.73
21_A	33_G	0.598	0.73
77_A	106_R	0.594	0.73
79_W	88_V	0.592	0.72
90_G	96_D	0.591	0.72
39_R	43_L	0.590	0.72
88_V	93_L	0.577	0.71
9_L	12_K	0.576	0.70
48_M	51_D	0.576	0.70
82_L	105_I	0.574	0.70
64_E	69_T	0.563	0.69
94_S	98_I	0.562	0.69
52_L	55_T	0.554	0.67
86_I	89_D	0.544	0.66
20_T	23_L	0.537	0.65
7_T	11_K	0.536	0.65
102_I	105_I	0.535	0.65
7_T	10_R	0.534	0.65
29_S	38_Y	0.531	0.64
85_T	93_L	0.529	0.64
101_L	106_R	0.528	0.64
81_S	91_Q	0.527	0.64
28_K	42_S	0.524	0.63
43_L	47_A	0.521	0.63
103_T	108_K	0.520	0.63
20_T	24_L	0.519	0.62
9_L	52_L	0.513	0.62
32_A	39_R	0.512	0.61
4_D	8_E	0.506	0.61
29_S	36_S	0.505	0.60
7_T	28_K	0.504	0.60
17_L	33_G	0.502	0.60
6_L	20_T	0.500	0.60
99_I	103_T	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ndwA	2	0.9914	99.8	0.368	Contact Map
4o8bA	2	0.8362	99.8	0.378	Contact Map
3r1fA	2	0.9914	99.8	0.384	Contact Map
1b0nA	2	0.8793	99.8	0.386	Contact Map
3qwgA	2	0.6897	99.8	0.392	Contact Map
4jcyA	2	0.7586	99.7	0.402	Contact Map
3op9A	4	0.8966	99.7	0.409	Contact Map
3ivpA	2	0.9138	99.7	0.426	Contact Map
2p5tA	2	0.3707	99.7	0.434	Contact Map
2ebyA	2	0.8448	99.6	0.449	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.