NRGB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NRGB - Nitrogen regulatory PII-like protein

UniProt:	Q07428	Sequences: MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (112)
Sequences:	2950 (1594)
Seq/√Len:	150.6

ECOLI - GLNB GLNK
BACSU - NRGB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_N	111_E	4.430	1.00
102_N	112_G	3.609	1.00
68_V	100_I	3.529	1.00
69_V	77_V	3.113	1.00
70_S	113_P	2.704	1.00
16_N	19_K	2.470	1.00
73_P	76_Q	2.428	1.00
20_L	85_L	2.321	1.00
82_K	86_K	2.287	1.00
27_I	80_T	2.252	1.00
10_I	81_A	2.234	1.00
33_T	37_V	2.128	1.00
9_E	98_Y	2.020	1.00
80_T	84_V	1.971	1.00
79_E	83_R	1.910	1.00
78_T	97_V	1.830	1.00
70_S	73_P	1.776	1.00
75_D	79_E	1.665	1.00
12_T	20_L	1.664	1.00
7_K	68_V	1.626	1.00
17_F	34_F	1.587	1.00
35_S	66_E	1.579	1.00
6_F	71_K	1.415	1.00
20_L	65_I	1.403	1.00
76_Q	80_T	1.379	1.00
35_S	64_K	1.319	1.00
71_K	113_P	1.301	1.00
8_V	77_V	1.299	1.00
78_T	95_I	1.295	1.00
79_E	82_K	1.251	1.00
76_Q	83_R	1.232	1.00
22_Q	26_K	1.219	1.00
82_K	111_E	1.215	1.00
9_E	64_K	1.213	1.00
6_F	99_E	1.200	1.00
8_V	69_V	1.198	1.00
6_F	101_S	1.189	1.00
7_K	98_Y	1.189	1.00
12_T	65_I	1.175	1.00
82_K	95_I	1.165	1.00
68_V	96_F	1.158	1.00
23_E	26_K	1.156	1.00
11_V	33_T	1.135	1.00
34_F	59_V	1.121	0.99
21_K	32_L	1.120	0.99
6_F	74_V	1.119	0.99
23_E	83_R	1.112	0.99
75_D	111_E	1.107	0.99
105_N	110_E	1.095	0.99
69_V	74_V	1.095	0.99
75_D	102_N	1.093	0.99
74_V	78_T	1.076	0.99
43_Q	60_Y	1.074	0.99
82_K	104_I	1.065	0.99
6_F	97_V	1.065	0.99
86_K	109_G	1.046	0.99
9_E	68_V	1.035	0.99
12_T	17_F	1.024	0.99
23_E	84_V	0.993	0.99
13_R	90_P	0.993	0.99
24_L	67_I	0.993	0.99
43_Q	62_R	0.989	0.99
96_F	106_I	0.984	0.99
17_F	63_L	0.965	0.98
25_G	40_C	0.955	0.98
46_H	58_N	0.948	0.98
107_R	110_E	0.947	0.98
40_C	46_H	0.934	0.98
88_G	92_D	0.928	0.98
76_Q	79_E	0.923	0.98
27_I	76_Q	0.912	0.98
8_V	81_A	0.901	0.98
67_I	77_V	0.900	0.98
13_R	37_V	0.895	0.97
29_V	67_I	0.890	0.97
73_P	77_V	0.879	0.97
5_M	71_K	0.869	0.97
87_T	92_D	0.852	0.97
23_E	80_T	0.851	0.97
40_C	58_N	0.844	0.96
78_T	104_I	0.840	0.96
51_R	55_I	0.834	0.96
103_T	115_A	0.832	0.96
31_S	40_C	0.793	0.95
104_I	111_E	0.790	0.95
11_V	96_F	0.771	0.94
17_F	58_N	0.767	0.94
24_L	81_A	0.739	0.93
47_T	54_K	0.734	0.92
50_Y	53_V	0.724	0.92
40_C	59_V	0.723	0.92
46_H	53_V	0.718	0.92
10_I	85_L	0.718	0.92
64_K	96_F	0.718	0.92
10_I	67_I	0.714	0.91
49_L	89_S	0.714	0.91
20_L	84_V	0.710	0.91
32_L	65_I	0.709	0.91
15_A	19_K	0.704	0.91
7_K	100_I	0.696	0.90
29_V	77_V	0.696	0.90
45_A	62_R	0.685	0.90
46_H	49_L	0.683	0.89
37_V	64_K	0.664	0.88
41_G	94_K	0.662	0.88
5_M	12_T	0.655	0.87
31_S	103_T	0.652	0.87
9_E	66_E	0.648	0.87
24_L	77_V	0.648	0.87
17_F	59_V	0.643	0.86
19_K	84_V	0.638	0.86
25_G	44_K	0.632	0.86
12_T	81_A	0.630	0.85
96_F	103_T	0.630	0.85
49_L	54_K	0.627	0.85
21_K	58_N	0.625	0.85
70_S	77_V	0.619	0.84
12_T	16_N	0.615	0.84
42_L	48_E	0.614	0.84
71_K	74_V	0.612	0.84
36_N	63_L	0.611	0.84
75_D	82_K	0.610	0.83
15_A	60_Y	0.601	0.83
26_K	83_R	0.599	0.82
74_V	99_E	0.597	0.82
49_L	53_V	0.590	0.81
83_R	86_K	0.590	0.81
40_C	106_I	0.587	0.81
74_V	102_N	0.587	0.81
54_K	89_S	0.580	0.80
7_K	96_F	0.577	0.80
21_K	25_G	0.574	0.80
43_Q	90_P	0.568	0.79
57_S	116_L	0.561	0.78
49_L	55_I	0.557	0.78
17_F	56_E	0.557	0.78
38_H	50_Y	0.557	0.78
9_E	103_T	0.555	0.77
34_F	65_I	0.549	0.77
74_V	97_V	0.548	0.76
72_V	83_R	0.547	0.76
104_I	115_A	0.547	0.76
33_T	48_E	0.546	0.76
17_F	65_I	0.543	0.76
61_E	89_S	0.542	0.76
49_L	58_N	0.541	0.76
15_A	59_V	0.541	0.76
47_T	56_E	0.541	0.76
95_I	104_I	0.539	0.75
83_R	111_E	0.537	0.75
24_L	65_I	0.537	0.75
32_L	66_E	0.537	0.75
46_H	54_K	0.536	0.75
13_R	89_S	0.534	0.75
24_L	76_Q	0.532	0.74
80_T	83_R	0.526	0.73
29_V	46_H	0.525	0.73
13_R	86_K	0.524	0.73
13_R	49_L	0.520	0.73
52_G	55_I	0.519	0.73
18_E	32_L	0.518	0.72
45_A	60_Y	0.516	0.72
81_A	85_L	0.514	0.72
7_K	66_E	0.511	0.71
15_A	55_I	0.508	0.71
78_T	82_K	0.506	0.71
12_T	72_V	0.500	0.70
31_S	60_Y	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ozjA	3	0.8793	100	0.2	Contact Map
2o66A	5	0.8707	100	0.204	Contact Map
3t9zA	3	0.8448	100	0.207	Contact Map
3ncqA	4	0.9655	100	0.216	Contact Map
4r25A	3	0.9828	100	0.22	Contact Map
1hwuA	6	0.9224	100	0.225	Contact Map
3bzqA	3	0.8534	100	0.225	Contact Map
1vfjA	3	0.9655	100	0.228	Contact Map
3l7pA	4	0.8017	100	0.232	Contact Map
2j9cA	3	0.9828	100	0.238	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.