ISPF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ISPF - 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

UniProt:	Q06756	Sequences: MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTVADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKPKMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	158 (155)
Sequences:	3001 (1709)
Seq/√Len:	137.2

ECOLI - ISPF
BACSU - ISPF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_P	25_E	3.107	1.00
75_F	120_G	2.664	1.00
34_G	38_A	2.606	1.00
14_V	33_L	2.380	1.00
80_H	83_G	2.377	1.00
42_L	117_I	2.290	1.00
41_L	97_C	2.255	1.00
6_Q	150_Q	2.226	1.00
45_V	95_I	2.197	1.00
22_G	41_L	2.186	1.00
49_C	85_V	2.175	1.00
82_W	121_L	2.028	1.00
10_V	138_L	2.014	1.00
103_K	144_A	1.926	1.00
46_A	81_V	1.891	1.00
45_V	97_C	1.852	1.00
80_H	84_I	1.792	1.00
141_T	148_A	1.756	1.00
100_I	150_Q	1.756	1.00
123_A	127_Q	1.742	1.00
135_T	141_T	1.736	1.00
60_K	110_I	1.675	1.00
93_G	156_Q	1.653	1.00
99_I	106_M	1.617	1.00
88_K	126_S	1.595	1.00
101_A	147_I	1.549	1.00
86_K	122_E	1.534	1.00
42_L	46_A	1.525	1.00
116_R	119_E	1.522	1.00
75_F	116_R	1.507	1.00
53_V	85_V	1.501	1.00
4_I	154_L	1.495	1.00
67_P	70_K	1.488	1.00
72_A	77_L	1.476	1.00
32_L	38_A	1.444	1.00
55_E	88_K	1.443	1.00
46_A	77_L	1.440	1.00
12_Q	33_L	1.436	1.00
6_Q	98_T	1.428	1.00
82_W	92_L	1.393	1.00
69_F	72_A	1.391	1.00
82_W	86_K	1.375	1.00
53_V	155_I	1.375	1.00
8_F	135_T	1.374	1.00
100_I	141_T	1.372	1.00
94_N	154_L	1.365	1.00
79_Q	120_G	1.357	1.00
56_G	60_K	1.353	1.00
41_L	99_I	1.351	1.00
76_K	79_Q	1.347	1.00
22_G	113_M	1.340	1.00
28_Y	144_A	1.325	1.00
96_D	131_K	1.313	1.00
85_V	155_I	1.309	1.00
92_L	123_A	1.307	1.00
124_D	127_Q	1.295	1.00
15_E	30_K	1.289	1.00
51_G	96_D	1.277	1.00
93_G	154_L	1.271	1.00
114_R	125_V	1.254	1.00
115_K	125_V	1.248	1.00
109_Y	112_D	1.232	1.00
115_K	119_E	1.229	1.00
117_I	130_V	1.211	1.00
20_I	25_E	1.199	1.00
6_Q	152_T	1.189	1.00
92_L	95_I	1.169	0.99
61_H	84_I	1.162	0.99
18_P	31_G	1.155	0.99
140_F	146_G	1.151	0.99
54_G	129_N	1.139	0.99
21_I	106_M	1.113	0.99
91_V	156_Q	1.112	0.99
86_K	91_V	1.095	0.99
50_L	81_V	1.095	0.99
51_G	131_K	1.092	0.99
107_L	111_E	1.089	0.99
111_E	114_R	1.089	0.99
83_G	87_Q	1.088	0.99
64_D	102_Q	1.084	0.99
69_F	77_L	1.076	0.99
68_E	80_H	1.071	0.99
60_K	107_L	1.069	0.99
106_M	110_I	1.064	0.99
44_T	151_A	1.061	0.99
10_V	135_T	1.059	0.99
111_E	125_V	1.053	0.99
72_A	76_K	1.052	0.99
26_I	109_Y	1.050	0.99
42_L	75_F	1.037	0.99
102_Q	135_T	1.029	0.99
111_E	115_K	1.026	0.99
52_A	155_I	1.020	0.99
102_Q	137_K	0.990	0.98
112_D	115_K	0.986	0.98
21_I	40_V	0.983	0.98
8_F	148_A	0.982	0.98
48_A	151_A	0.981	0.98
32_L	101_A	0.980	0.98
14_V	17_R	0.965	0.98
45_V	117_I	0.963	0.98
29_E	103_K	0.951	0.98
105_K	108_P	0.942	0.98
47_D	58_I	0.926	0.97
7_G	47_D	0.921	0.97
46_A	72_A	0.906	0.97
95_I	121_L	0.904	0.97
8_F	100_I	0.900	0.97
2_F	93_G	0.896	0.97
101_A	106_M	0.892	0.97
100_I	148_A	0.887	0.96
17_R	33_L	0.854	0.96
49_C	155_I	0.853	0.96
42_L	120_G	0.850	0.95
17_R	31_G	0.846	0.95
46_A	58_I	0.845	0.95
138_L	146_G	0.842	0.95
116_R	120_G	0.837	0.95
30_K	144_A	0.837	0.95
90_Y	155_I	0.834	0.95
106_M	132_A	0.830	0.95
62_F	80_H	0.826	0.95
48_A	153_V	0.815	0.94
139_G	146_G	0.815	0.94
95_I	153_V	0.814	0.94
32_L	147_I	0.807	0.94
55_E	84_I	0.804	0.94
54_G	114_R	0.804	0.94
29_E	144_A	0.797	0.94
137_K	144_A	0.791	0.93
110_I	114_R	0.778	0.93
75_F	79_Q	0.778	0.93
21_I	147_I	0.765	0.92
100_I	135_T	0.754	0.92
77_L	81_V	0.752	0.92
56_G	61_H	0.749	0.91
64_D	136_E	0.745	0.91
19_L	147_I	0.736	0.91
82_W	123_A	0.735	0.91
64_D	69_F	0.723	0.90
76_K	80_H	0.722	0.90
135_T	140_F	0.717	0.89
135_T	143_R	0.715	0.89
133_T	146_G	0.701	0.88
20_I	116_R	0.699	0.88
40_V	147_I	0.698	0.88
135_T	148_A	0.698	0.88
10_V	146_G	0.696	0.88
117_I	128_V	0.696	0.88
22_G	99_I	0.695	0.88
10_V	140_F	0.695	0.88
47_D	133_T	0.693	0.88
60_K	114_R	0.683	0.87
84_I	88_K	0.682	0.87
27_P	109_Y	0.682	0.87
12_Q	137_K	0.680	0.87
17_R	38_A	0.679	0.87
106_M	109_Y	0.679	0.87
82_W	122_E	0.672	0.86
95_I	123_A	0.671	0.86
91_V	127_Q	0.670	0.86
17_R	71_D	0.665	0.86
40_V	149_A	0.659	0.85
13_L	32_L	0.658	0.85
108_P	111_E	0.657	0.85
2_F	154_L	0.652	0.85
10_V	141_T	0.642	0.84
14_V	30_K	0.642	0.84
99_I	149_A	0.640	0.83
84_I	87_Q	0.639	0.83
79_Q	122_E	0.636	0.83
8_F	150_Q	0.634	0.83
23_G	117_I	0.623	0.82
13_L	30_K	0.620	0.81
19_L	32_L	0.620	0.81
93_G	123_A	0.614	0.81
107_L	110_I	0.613	0.81
112_D	116_R	0.613	0.81
113_M	116_R	0.611	0.81
22_G	97_C	0.611	0.81
8_F	140_F	0.610	0.80
80_H	87_Q	0.606	0.80
135_T	138_L	0.606	0.80
82_W	95_I	0.604	0.80
49_C	53_V	0.603	0.80
98_T	129_N	0.602	0.80
2_F	156_Q	0.595	0.79
54_G	94_N	0.593	0.79
33_L	64_D	0.591	0.78
101_A	141_T	0.585	0.78
4_I	152_T	0.577	0.77
85_V	90_Y	0.575	0.76
67_P	71_D	0.573	0.76
19_L	31_G	0.571	0.76
113_M	130_V	0.569	0.76
78_L	120_G	0.566	0.75
17_R	20_I	0.564	0.75
92_L	128_V	0.563	0.75
20_I	31_G	0.562	0.75
13_L	17_R	0.552	0.73
61_H	129_N	0.550	0.73
137_K	143_R	0.547	0.73
66_D	69_F	0.544	0.72
7_G	58_I	0.544	0.72
5_G	52_A	0.544	0.72
102_Q	142_G	0.541	0.72
53_V	88_K	0.537	0.71
73_D	77_L	0.532	0.71
20_I	38_A	0.531	0.71
82_W	117_I	0.526	0.70
139_G	142_G	0.526	0.70
73_D	76_K	0.524	0.70
117_I	121_L	0.524	0.70
110_I	113_M	0.522	0.69
68_E	119_E	0.521	0.69
13_L	147_I	0.520	0.69
24_I	75_F	0.518	0.69
17_R	25_E	0.518	0.69
98_T	150_Q	0.516	0.68
61_H	81_V	0.513	0.68
83_G	86_K	0.511	0.68
41_L	45_V	0.511	0.68
12_Q	138_L	0.509	0.67
10_V	139_G	0.509	0.67
60_K	129_N	0.508	0.67
118_A	128_V	0.505	0.67
99_I	147_I	0.504	0.67
7_G	10_V	0.503	0.66
49_C	92_L	0.502	0.66
13_L	146_G	0.502	0.66
141_T	146_G	0.501	0.66
10_V	133_T	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4c8eA	3	1	100	0.014	Contact Map
3f0dA	3	0.9873	100	0.015	Contact Map
1t0aA	3	1	100	0.017	Contact Map
3re3A	5	0.9241	100	0.018	Contact Map
1yqnA	3	0.9937	100	0.019	Contact Map
2pmpA	3	1	100	0.02	Contact Map
5b8fA	3	1	100	0.024	Contact Map
2uzhA	3	0.981	100	0.04	Contact Map
4c81A	3	0.9367	100	0.041	Contact Map
3b6nA	3	0.8924	100	0.052	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.