CYSE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CYSE - Serine acetyltransferase

UniProt:	Q06750	Sequences: MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGIPGRVVVQNGKKVRRDLNHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	217 (175)
Sequences:	2540 (1286)
Seq/√Len:	97.2

ECOLI - CYSE WCAB
BACSU - CYSE
HALSA - Q9HPT3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
122_K	141_E	4.834	1.00
121_I	127_I	4.207	1.00
124_D	142_G	3.609	1.00
123_D	141_E	3.169	1.00
78_R	98_N	3.089	1.00
161_V	166_G	3.022	1.00
122_K	138_T	2.953	1.00
142_G	158_F	2.763	1.00
137_I	154_D	2.735	1.00
8_E	77_R	2.639	1.00
44_A	48_R	2.458	1.00
96_G	123_D	2.335	1.00
11_D	23_Y	2.308	1.00
77_R	97_N	2.307	1.00
116_K	120_T	2.290	1.00
141_E	157_D	2.164	1.00
99_V	121_I	2.149	1.00
155_V	161_V	2.118	1.00
67_I	84_G	2.107	1.00
74_T	94_E	2.037	1.00
14_F	23_Y	2.036	1.00
8_E	78_R	2.017	1.00
96_G	122_K	1.994	1.00
28_L	52_F	1.974	1.00
97_N	123_D	1.974	1.00
51_Y	54_A	1.911	1.00
81_I	87_V	1.883	1.00
38_A	61_S	1.874	1.00
98_N	124_D	1.842	1.00
76_G	97_N	1.834	1.00
156_P	168_V	1.817	1.00
138_T	154_D	1.809	1.00
33_L	37_W	1.807	1.00
121_I	139_V	1.796	1.00
143_S	155_V	1.715	1.00
143_S	159_S	1.668	1.00
60_V	64_F	1.604	1.00
132_K	148_G	1.601	1.00
52_F	56_L	1.590	1.00
12_T	16_Q	1.577	1.00
75_I	95_I	1.525	1.00
159_S	168_V	1.519	1.00
101_V	127_I	1.513	1.00
16_Q	100_T	1.482	1.00
79_F	123_D	1.470	1.00
94_E	136_S	1.414	1.00
29_T	52_F	1.374	0.99
36_I	79_F	1.369	0.99
143_S	157_D	1.360	0.99
66_G	85_M	1.356	0.99
39_H	61_S	1.286	0.99
98_N	123_D	1.248	0.99
146_G	162_V	1.246	0.99
43_H	47_K	1.245	0.99
124_D	141_E	1.238	0.99
139_V	145_I	1.236	0.99
161_V	168_V	1.233	0.99
130_G	148_G	1.229	0.99
45_L	53_L	1.225	0.99
20_A	26_V	1.195	0.98
144_K	160_T	1.192	0.98
68_E	85_M	1.185	0.98
9_D	40_R	1.181	0.98
133_V	137_I	1.177	0.98
43_H	74_T	1.160	0.98
79_F	95_I	1.144	0.98
62_R	85_M	1.140	0.98
75_I	79_F	1.139	0.98
139_V	143_S	1.116	0.97
122_K	157_D	1.093	0.97
10_I	27_I	1.080	0.97
10_I	33_L	1.077	0.97
29_T	56_L	1.072	0.97
99_V	123_D	1.053	0.96
10_I	23_Y	1.042	0.96
58_S	68_E	1.037	0.96
50_F	54_A	1.035	0.96
75_I	89_I	1.025	0.96
140_G	157_D	1.022	0.96
94_E	120_T	1.016	0.95
156_P	159_S	1.006	0.95
174_K	177_R	0.993	0.95
133_V	145_I	0.976	0.94
128_A	152_L	0.974	0.94
158_F	172_N	0.971	0.94
173_G	176_V	0.970	0.94
103_Q	106_T	0.966	0.94
46_Y	51_Y	0.965	0.94
60_V	63_F	0.964	0.94
79_F	101_V	0.960	0.94
14_F	26_V	0.951	0.94
159_S	171_Q	0.949	0.94
42_A	57_I	0.947	0.93
20_A	30_Y	0.945	0.93
160_T	169_V	0.932	0.93
113_E	136_S	0.928	0.93
13_V	33_L	0.925	0.93
120_T	136_S	0.924	0.93
86_G	104_G	0.912	0.92
72_G	91_E	0.901	0.92
21_R	25_E	0.879	0.91
172_N	175_K	0.876	0.90
13_V	80_F	0.875	0.90
80_F	100_T	0.868	0.90
24_F	28_L	0.858	0.90
149_S	165_P	0.856	0.89
11_D	15_D	0.839	0.88
26_V	30_Y	0.835	0.88
21_R	51_Y	0.830	0.88
59_Q	68_E	0.823	0.88
150_V	164_I	0.813	0.87
139_V	154_D	0.805	0.86
50_F	53_L	0.805	0.86
59_Q	63_F	0.802	0.86
103_Q	112_K	0.801	0.86
45_L	50_F	0.797	0.86
96_G	138_T	0.794	0.86
101_V	121_I	0.791	0.85
37_W	41_I	0.788	0.85
19_A	30_Y	0.784	0.85
94_E	116_K	0.776	0.84
171_Q	174_K	0.772	0.84
99_V	141_E	0.765	0.83
77_R	98_N	0.761	0.83
104_G	130_G	0.750	0.82
29_T	59_Q	0.744	0.82
38_A	60_V	0.740	0.81
122_K	143_S	0.735	0.81
127_I	131_A	0.734	0.81
59_Q	85_M	0.734	0.81
149_S	166_G	0.732	0.81
162_V	166_G	0.732	0.81
22_S	26_V	0.731	0.81
147_A	163_G	0.731	0.81
12_T	78_R	0.731	0.81
5_M	77_R	0.729	0.80
172_N	176_V	0.719	0.79
119_P	135_G	0.718	0.79
96_G	141_E	0.716	0.79
9_D	37_W	0.714	0.79
170_V	175_K	0.714	0.79
7_K	11_D	0.712	0.79
44_A	47_K	0.708	0.78
6_L	37_W	0.703	0.78
38_A	42_A	0.698	0.77
20_A	34_H	0.695	0.77
141_E	158_F	0.691	0.77
89_I	95_I	0.689	0.76
151_V	166_G	0.687	0.76
29_T	126_L	0.685	0.76
35_A	67_I	0.684	0.76
31_S	62_R	0.680	0.76
82_D	117_R	0.676	0.75
7_K	23_Y	0.675	0.75
76_G	98_N	0.665	0.74
145_I	161_V	0.664	0.74
93_C	121_I	0.664	0.74
156_P	161_V	0.656	0.73
110_T	160_T	0.654	0.73
47_K	74_T	0.652	0.72
3_F	6_L	0.651	0.72
56_L	60_V	0.650	0.72
39_H	58_S	0.649	0.72
22_S	25_E	0.648	0.72
161_V	169_V	0.646	0.72
12_T	98_N	0.644	0.72
149_S	161_V	0.644	0.72
10_I	26_V	0.640	0.71
92_T	118_H	0.638	0.71
81_I	101_V	0.635	0.70
39_H	75_I	0.633	0.70
110_T	144_K	0.632	0.70
69_I	75_I	0.631	0.70
71_P	117_R	0.629	0.70
104_G	132_K	0.627	0.70
112_K	148_G	0.623	0.69
151_V	163_G	0.621	0.69
124_D	158_F	0.615	0.68
44_A	49_K	0.614	0.68
111_G	115_G	0.610	0.67
111_G	152_L	0.609	0.67
47_K	177_R	0.608	0.67
127_I	145_I	0.608	0.67
42_A	61_S	0.605	0.67
112_K	136_S	0.603	0.67
148_G	164_I	0.601	0.66
46_Y	70_H	0.597	0.66
12_T	100_T	0.595	0.66
71_P	118_H	0.595	0.66
158_F	171_Q	0.595	0.66
150_V	163_G	0.589	0.65
163_G	166_G	0.588	0.65
3_F	7_K	0.588	0.65
112_K	115_G	0.588	0.65
25_E	55_R	0.587	0.64
95_I	127_I	0.586	0.64
53_L	57_I	0.585	0.64
46_Y	72_G	0.583	0.64
171_Q	176_V	0.583	0.64
88_V	118_H	0.580	0.64
18_P	82_D	0.577	0.63
132_K	164_I	0.577	0.63
32_G	35_A	0.576	0.63
8_E	15_D	0.570	0.62
132_K	150_V	0.569	0.62
143_S	168_V	0.568	0.62
160_T	167_R	0.568	0.62
143_S	158_F	0.567	0.62
38_A	57_I	0.566	0.62
36_I	75_I	0.565	0.62
68_E	84_G	0.561	0.61
107_L	118_H	0.559	0.61
5_M	33_L	0.559	0.61
83_H	88_V	0.557	0.60
45_L	54_A	0.555	0.60
71_P	82_D	0.553	0.60
71_P	92_T	0.551	0.60
27_I	37_W	0.551	0.60
100_T	126_L	0.550	0.60
90_G	118_H	0.549	0.59
170_V	173_G	0.547	0.59
172_N	177_R	0.544	0.59
95_I	121_I	0.542	0.58
62_R	68_E	0.541	0.58
83_H	119_P	0.540	0.58
82_D	118_H	0.537	0.58
78_R	111_G	0.536	0.58
70_H	117_R	0.535	0.57
45_L	57_I	0.533	0.57
63_F	85_M	0.533	0.57
11_D	26_V	0.532	0.57
110_T	113_E	0.530	0.57
38_A	64_F	0.528	0.56
103_Q	129_T	0.527	0.56
70_H	90_G	0.526	0.56
158_F	174_K	0.525	0.56
82_D	90_G	0.525	0.56
81_I	84_G	0.524	0.56
25_E	29_T	0.524	0.56
149_S	163_G	0.523	0.56
4_R	77_R	0.522	0.56
14_F	79_F	0.522	0.56
41_I	48_R	0.519	0.55
55_R	58_S	0.517	0.55
159_S	170_V	0.515	0.55
144_K	152_L	0.514	0.54
103_Q	136_S	0.513	0.54
92_T	117_R	0.513	0.54
31_S	59_Q	0.511	0.54
8_E	98_N	0.508	0.54
19_A	109_G	0.508	0.54
71_P	90_G	0.508	0.54
153_H	169_V	0.508	0.54
17_D	82_D	0.503	0.53
4_R	152_L	0.503	0.53
142_G	172_N	0.503	0.53
49_K	53_L	0.502	0.53
83_H	135_G	0.502	0.53
145_I	166_G	0.501	0.53
15_D	27_I	0.501	0.53
151_V	155_V	0.500	0.52
82_D	92_T	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n6aA	3	0.7788	100	0.372	Contact Map
3q1xA	3	0.7465	100	0.404	Contact Map
1ssqA	6	0.8571	100	0.405	Contact Map
4h7oA	6	0.8618	100	0.405	Contact Map
4hzdA	5	0.8065	100	0.428	Contact Map
3f1xA	6	0.7465	100	0.43	Contact Map
4hurA	3	0.7926	100	0.561	Contact Map
1mr7A	3	0.7742	100	0.566	Contact Map
3fttA	3	0.7834	100	0.572	Contact Map
1krrA	3	0.8249	100	0.573	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.