YMXH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YMXH - Uncharacterized protein YmxH

UniProt:	Q04811	Sequences: MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIGSDMIILDVPEEMPPRQE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	85 (76)
Sequences:	344 (211)
Seq/√Len:	24.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_N	38_T	5.648	1.00
65_Q	75_D	3.770	1.00
13_D	16_R	3.009	1.00
40_L	60_P	2.349	0.98
27_D	30_I	2.339	0.98
6_L	76_V	1.906	0.93
13_D	18_E	1.892	0.93
56_D	73_I	1.889	0.92
10_E	43_P	1.869	0.92
39_A	50_L	1.851	0.92
13_D	71_M	1.752	0.89
11_I	73_I	1.640	0.86
10_E	22_V	1.620	0.85
29_E	41_L	1.605	0.85
36_Q	47_W	1.517	0.81
2_R	32_E	1.333	0.72
6_L	75_D	1.293	0.69
47_W	56_D	1.282	0.69
17_A	59_V	1.226	0.65
7_S	10_E	1.198	0.63
62_H	77_P	1.123	0.58
8_G	73_I	1.121	0.58
15_K	75_D	1.113	0.57
11_I	32_E	1.082	0.55
8_G	12_V	1.053	0.53
24_G	42_I	1.049	0.53
48_F	54_G	1.042	0.52
29_E	73_I	1.036	0.52
7_S	12_V	1.020	0.51
19_R	43_P	1.019	0.51
59_V	74_L	1.008	0.50
28_L	55_H	0.998	0.49
16_R	59_V	0.994	0.49
48_F	67_I	0.976	0.48
7_S	64_I	0.975	0.48
19_R	24_G	0.967	0.47
23_L	51_R	0.947	0.46
39_A	66_K	0.941	0.45
29_E	32_E	0.936	0.45
17_A	71_M	0.933	0.45
33_Q	47_W	0.930	0.44
2_R	71_M	0.927	0.44
6_L	46_K	0.913	0.43
14_I	73_I	0.909	0.43
43_P	47_W	0.907	0.43
55_H	77_P	0.905	0.43
42_I	47_W	0.901	0.42
46_K	54_G	0.889	0.42
13_D	58_R	0.889	0.42
7_S	24_G	0.876	0.41
48_F	66_K	0.870	0.40
11_I	23_L	0.866	0.40
40_L	74_L	0.865	0.40
9_K	24_G	0.863	0.40
40_L	58_R	0.862	0.40
20_L	74_L	0.860	0.40
64_I	70_D	0.859	0.39
71_M	74_L	0.849	0.39
3_L	10_E	0.833	0.38
30_I	34_D	0.832	0.38
6_L	63_H	0.814	0.36
28_L	54_G	0.812	0.36
29_E	56_D	0.804	0.36
34_D	39_A	0.802	0.36
63_H	75_D	0.787	0.35
42_I	70_D	0.779	0.34
4_S	61_W	0.764	0.33
40_L	64_I	0.755	0.33
23_L	44_T	0.745	0.32
33_Q	72_I	0.741	0.32
14_I	20_L	0.738	0.32
7_S	75_D	0.738	0.32
29_E	70_D	0.732	0.31
24_G	28_L	0.731	0.31
23_L	58_R	0.710	0.30
2_R	34_D	0.708	0.30
17_A	40_L	0.698	0.29
4_S	71_M	0.694	0.29
45_V	70_D	0.694	0.29
1_M	32_E	0.688	0.29
19_R	75_D	0.687	0.29
57_I	78_E	0.679	0.28
42_I	45_V	0.678	0.28
7_S	71_M	0.674	0.28
36_Q	62_H	0.665	0.27
59_V	69_S	0.662	0.27
5_E	12_V	0.661	0.27
11_I	48_F	0.651	0.26
46_K	49_G	0.649	0.26
29_E	58_R	0.640	0.26
11_I	43_P	0.639	0.26
22_V	53_Q	0.619	0.25
9_K	59_V	0.612	0.24
36_Q	50_L	0.607	0.24
44_T	69_S	0.606	0.24
24_G	41_L	0.597	0.24
1_M	43_P	0.590	0.23
12_V	55_H	0.585	0.23
12_V	62_H	0.581	0.23
15_K	19_R	0.579	0.23
57_I	64_I	0.575	0.22
37_I	64_I	0.574	0.22
69_S	72_I	0.567	0.22
30_I	56_D	0.566	0.22
65_Q	78_E	0.556	0.22
29_E	49_G	0.532	0.20
67_I	77_P	0.528	0.20
7_S	51_R	0.521	0.20
46_K	71_M	0.521	0.20
27_D	70_D	0.520	0.20
39_A	48_F	0.519	0.20
5_E	24_G	0.503	0.19
3_L	32_E	0.501	0.19
2_R	69_S	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pm3A	2	0.8	99.8	0.437	Contact Map
3htrA	2	0.9294	99.4	0.587	Contact Map
1eysH	1	0.8824	95.7	0.814	Contact Map
2wjnH	1	0.8824	93.5	0.835	Contact Map
1rzhH	1	0.8706	91.3	0.845	Contact Map
4da2A	1	0.9176	16.9	0.916	Contact Map
1a62A	1	1	10.7	0.924	Contact Map
3k44A	1	0.4706	6	0.932	Contact Map
2gj2A	3	0.5176	5.7	0.933	Contact Map
4q8wA	2	0.7882	5.3	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.