DPAB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DPAB - Dipicolinate synthase subunit B

UniProt:	Q04810	Sequences: MSSLKGKRIGFGLTGSHCTYEAVFPQIEELVNEGAEVRPVVTFNVKSTNTRFGEGAEWVKKIEDLTGYEAIDSIVKAEPLGPKLPLDCMVIAPLTGNSMSKLANAMTDSPVLMAAKATIRNNRPVVLGISTNDALGLNGTNLMRLMSTKNIFFIPFGQDDPFKKPNSMVAKMDLLPQTIEKALMHQQLQPILVENYQGND	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	200 (190)
Sequences:	368 (241)
Seq/√Len:	17.5

BACSU - DPAB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_I	115_A	5.495	1.00
71_I	77_A	4.912	1.00
126_V	178_T	4.304	1.00
128_G	154_I	3.456	1.00
63_E	69_E	3.344	0.99
28_E	32_N	3.342	0.99
54_E	57_E	3.072	0.99
43_F	110_P	2.970	0.99
12_G	89_M	2.957	0.99
146_M	191_I	2.930	0.99
31_V	37_V	2.898	0.98
36_E	68_Y	2.791	0.98
72_D	76_K	2.705	0.97
134_A	168_M	2.693	0.97
140_T	144_R	2.651	0.97
8_R	36_E	2.616	0.97
84_L	123_R	2.474	0.96
49_N	55_G	2.470	0.96
88_C	126_V	2.392	0.95
168_M	192_L	2.248	0.93
46_K	72_D	2.173	0.91
139_G	143_M	2.100	0.90
99_M	142_L	2.068	0.89
160_D	163_K	1.962	0.86
181_K	188_L	1.907	0.85
90_V	179_I	1.776	0.80
80_L	143_M	1.771	0.80
8_R	38_R	1.754	0.79
152_F	185_H	1.706	0.77
26_Q	29_E	1.667	0.76
12_G	98_S	1.662	0.75
28_E	61_K	1.653	0.75
24_F	62_I	1.623	0.74
128_G	172_M	1.607	0.73
90_V	175_L	1.546	0.70
94_L	99_M	1.512	0.68
12_G	111_V	1.491	0.67
63_E	70_A	1.479	0.66
12_G	40_V	1.460	0.65
174_L	188_L	1.456	0.65
11_F	23_V	1.449	0.65
154_I	175_L	1.440	0.64
27_I	62_I	1.425	0.63
139_G	146_M	1.420	0.63
38_R	86_L	1.404	0.62
128_G	170_A	1.393	0.62
99_M	129_I	1.369	0.60
71_I	80_L	1.364	0.60
24_F	61_K	1.346	0.59
17_H	58_W	1.344	0.59
156_F	192_L	1.295	0.56
178_T	188_L	1.286	0.55
74_I	113_M	1.258	0.54
131_T	142_L	1.257	0.54
91_I	127_L	1.244	0.53
171_K	193_V	1.234	0.52
13_L	27_I	1.227	0.52
149_K	166_N	1.209	0.51
6_G	35_A	1.201	0.50
117_A	138_N	1.184	0.49
127_L	130_S	1.178	0.49
131_T	134_A	1.164	0.48
140_T	143_M	1.146	0.47
11_F	92_A	1.131	0.46
171_K	174_L	1.091	0.44
24_F	58_W	1.088	0.43
9_I	88_C	1.069	0.42
80_L	85_P	1.065	0.42
27_I	151_I	1.056	0.41
118_T	125_V	1.048	0.41
40_V	80_L	1.041	0.41
52_F	114_A	1.036	0.40
145_L	153_F	1.028	0.40
40_V	89_M	1.027	0.40
94_L	98_S	1.026	0.40
31_V	66_T	1.014	0.39
92_A	188_L	1.012	0.39
92_A	175_L	1.007	0.39
181_K	186_Q	0.985	0.37
86_L	170_A	0.980	0.37
100_S	105_A	0.979	0.37
126_V	179_I	0.979	0.37
33_E	176_P	0.970	0.36
59_V	62_I	0.963	0.36
157_G	168_M	0.957	0.36
51_R	67_G	0.951	0.35
15_G	49_N	0.951	0.35
131_T	189_Q	0.950	0.35
9_I	12_G	0.946	0.35
134_A	169_V	0.940	0.35
71_I	76_K	0.939	0.35
91_I	109_S	0.936	0.35
80_L	118_T	0.934	0.34
39_P	62_I	0.927	0.34
41_V	70_A	0.908	0.33
41_V	45_V	0.906	0.33
88_C	179_I	0.905	0.33
105_A	109_S	0.904	0.33
148_T	166_N	0.900	0.33
138_N	151_I	0.898	0.33
96_G	138_N	0.897	0.32
28_E	64_D	0.884	0.32
56_A	60_K	0.881	0.32
14_T	113_M	0.879	0.32
11_F	90_V	0.876	0.31
85_P	143_M	0.868	0.31
29_E	33_E	0.868	0.31
177_Q	185_H	0.863	0.31
94_L	143_M	0.861	0.31
102_L	115_A	0.857	0.30
169_V	172_M	0.856	0.30
36_E	57_E	0.854	0.30
85_P	117_A	0.847	0.30
101_K	143_M	0.838	0.29
20_Y	58_W	0.838	0.29
22_A	160_D	0.833	0.29
112_L	137_L	0.826	0.29
61_K	142_L	0.825	0.29
41_V	147_S	0.824	0.29
175_L	188_L	0.823	0.29
122_N	150_N	0.822	0.29
13_L	139_G	0.820	0.29
119_I	150_N	0.815	0.28
115_A	177_Q	0.812	0.28
178_T	181_K	0.812	0.28
118_T	143_M	0.808	0.28
22_A	175_L	0.805	0.28
56_A	71_I	0.804	0.28
89_M	98_S	0.802	0.28
130_S	145_L	0.799	0.28
49_N	57_E	0.797	0.27
117_A	161_P	0.795	0.27
97_N	101_K	0.786	0.27
134_A	192_L	0.785	0.27
110_P	136_G	0.780	0.27
7_K	184_M	0.778	0.27
157_G	193_V	0.768	0.26
37_V	193_V	0.758	0.26
59_V	63_E	0.757	0.26
41_V	72_D	0.757	0.26
42_T	102_L	0.753	0.25
36_E	142_L	0.753	0.25
18_C	52_F	0.751	0.25
20_Y	24_F	0.751	0.25
166_N	186_Q	0.744	0.25
106_M	143_M	0.743	0.25
134_A	153_F	0.741	0.25
44_N	48_T	0.737	0.25
13_L	131_T	0.730	0.24
103_A	161_P	0.728	0.24
17_H	100_S	0.721	0.24
12_G	94_L	0.721	0.24
90_V	126_V	0.718	0.24
22_A	127_L	0.717	0.24
42_T	94_L	0.714	0.24
66_T	136_G	0.712	0.24
89_M	129_I	0.711	0.23
136_G	166_N	0.702	0.23
4_L	35_A	0.701	0.23
6_G	31_V	0.700	0.23
96_G	104_N	0.700	0.23
112_L	115_A	0.700	0.23
53_G	165_P	0.698	0.23
46_K	70_A	0.695	0.23
29_E	32_N	0.692	0.23
76_K	84_L	0.689	0.23
146_M	156_F	0.688	0.22
15_G	169_V	0.687	0.22
130_S	137_L	0.683	0.22
97_N	143_M	0.681	0.22
50_T	112_L	0.679	0.22
25_P	100_S	0.677	0.22
30_L	162_F	0.675	0.22
137_L	172_M	0.674	0.22
35_A	126_V	0.670	0.22
27_I	156_F	0.668	0.22
9_I	30_L	0.668	0.22
142_L	188_L	0.667	0.22
125_V	135_L	0.666	0.22
106_M	147_S	0.666	0.22
48_T	75_V	0.662	0.21
41_V	59_V	0.660	0.21
86_L	89_M	0.658	0.21
13_L	191_I	0.653	0.21
8_R	68_Y	0.653	0.21
122_N	160_D	0.650	0.21
24_F	53_G	0.648	0.21
79_P	103_A	0.643	0.21
115_A	131_T	0.640	0.21
143_M	147_S	0.640	0.21
28_E	188_L	0.633	0.20
117_A	151_I	0.633	0.20
46_K	172_M	0.632	0.20
83_K	169_V	0.631	0.20
104_N	138_N	0.630	0.20
11_F	125_V	0.630	0.20
112_L	157_G	0.628	0.20
79_P	83_K	0.627	0.20
30_L	175_L	0.627	0.20
60_K	64_D	0.626	0.20
31_V	65_L	0.625	0.20
115_A	125_V	0.623	0.20
35_A	88_C	0.622	0.20
58_W	171_K	0.621	0.20
137_L	148_T	0.620	0.20
53_G	185_H	0.616	0.20
140_T	148_T	0.615	0.20
13_L	32_N	0.614	0.20
97_N	106_M	0.614	0.20
94_L	139_G	0.614	0.20
15_G	44_N	0.611	0.19
158_Q	187_Q	0.611	0.19
32_N	163_K	0.607	0.19
19_T	134_A	0.605	0.19
99_M	193_V	0.603	0.19
17_H	172_M	0.602	0.19
128_G	139_G	0.601	0.19
107_T	130_S	0.598	0.19
38_R	80_L	0.598	0.19
7_K	180_E	0.595	0.19
121_N	142_L	0.594	0.19
27_I	37_V	0.592	0.19
42_T	46_K	0.589	0.19
9_I	98_S	0.587	0.18
42_T	176_P	0.582	0.18
40_V	84_L	0.582	0.18
17_H	45_V	0.577	0.18
41_V	62_I	0.577	0.18
57_E	174_L	0.577	0.18
9_I	75_V	0.574	0.18
61_K	149_K	0.574	0.18
27_I	34_G	0.574	0.18
159_D	167_S	0.574	0.18
153_F	165_P	0.573	0.18
14_T	112_L	0.572	0.18
165_P	189_Q	0.570	0.18
89_M	183_L	0.570	0.18
28_E	36_E	0.568	0.18
29_E	177_Q	0.567	0.18
17_H	105_A	0.567	0.18
22_A	118_T	0.566	0.18
97_N	107_T	0.565	0.18
125_V	171_K	0.563	0.18
80_L	105_A	0.562	0.18
42_T	49_N	0.556	0.17
94_L	142_L	0.555	0.17
104_N	166_N	0.553	0.17
160_D	173_D	0.551	0.17
58_W	118_T	0.551	0.17
107_T	112_L	0.546	0.17
59_V	70_A	0.545	0.17
26_Q	177_Q	0.545	0.17
88_C	147_S	0.544	0.17
137_L	143_M	0.544	0.17
86_L	119_I	0.540	0.17
41_V	140_T	0.539	0.17
97_N	134_A	0.538	0.17
24_F	139_G	0.536	0.17
57_E	171_K	0.535	0.17
38_R	169_V	0.535	0.17
187_Q	190_P	0.534	0.17
42_T	106_M	0.532	0.17
49_N	66_T	0.532	0.17
85_P	88_C	0.531	0.17
9_I	56_A	0.531	0.17
14_T	130_S	0.527	0.16
21_E	40_V	0.523	0.16
20_Y	117_A	0.523	0.16
80_L	86_L	0.523	0.16
9_I	20_Y	0.522	0.16
20_Y	100_S	0.522	0.16
140_T	147_S	0.522	0.16
45_V	165_P	0.521	0.16
44_N	150_N	0.521	0.16
88_C	183_L	0.520	0.16
56_A	162_F	0.519	0.16
68_Y	99_M	0.515	0.16
94_L	127_L	0.512	0.16
111_V	157_G	0.511	0.16
10_G	86_L	0.508	0.16
51_R	181_K	0.505	0.16
4_L	26_Q	0.504	0.16
80_L	100_S	0.504	0.16
135_L	139_G	0.503	0.16
104_N	150_N	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lqkA	5	0.975	100	0.586	Contact Map
3mcuA	5	0.94	100	0.597	Contact Map
1p3y1	6	0.805	100	0.679	Contact Map
1sbzA	6	0.905	100	0.714	Contact Map
4zavA	6	0.96	100	0.719	Contact Map
1qzuA	3	0.76	100	0.719	Contact Map
4rhfA	6	0.94	100	0.719	Contact Map
1mvlA	3	0.79	100	0.734	Contact Map
3qjgA	5	0.79	99.9	0.749	Contact Map
2ejbA	6	0.855	99.9	0.752	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.