DINB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DINB - Protein DinB

UniProt:	Q02886	Sequences: MSDFAFKLYEYNVWANQQIFNRLKELPKEIYHQEIQSVFPSISHVLSHVYLSDLGWIEVFSGKTLSDALALAEQLKEQTEAKEIEEMEDLFLRLSERYILFLQQKEQLNKPLQIQNPSSGIMKTTVSELLPHVVNHGTYHRGNITAMLRQAGYASAPTDYGLYLFMTKTEKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (153)
Sequences:	1364 (1078)
Seq/√Len:	87.1

BACSU - DINB YIST

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_Y	43_S	4.288	1.00
24_K	88_E	3.648	1.00
42_I	144_I	3.630	1.00
113_Q	123_K	3.583	1.00
135_N	138_T	3.560	1.00
83_E	86_E	2.623	1.00
32_H	43_S	2.529	1.00
37_S	147_M	2.473	1.00
60_F	129_L	2.381	1.00
7_K	160_Y	2.221	1.00
27_P	30_I	2.207	1.00
30_I	33_Q	2.195	1.00
98_Y	133_V	2.176	1.00
96_E	100_L	2.081	1.00
88_E	92_L	2.036	1.00
35_I	151_A	2.001	1.00
6_F	103_Q	1.977	1.00
16_N	95_S	1.961	1.00
60_F	126_V	1.900	1.00
110_K	126_V	1.866	1.00
59_V	114_I	1.843	1.00
115_Q	121_I	1.773	1.00
9_Y	134_V	1.620	1.00
113_Q	121_I	1.617	1.00
29_E	33_Q	1.606	1.00
12_N	137_G	1.582	1.00
28_K	32_H	1.574	1.00
50_Y	90_L	1.538	1.00
11_Y	135_N	1.484	0.99
111_P	123_K	1.484	0.99
91_F	95_S	1.479	0.99
22_R	153_Y	1.460	0.99
25_E	153_Y	1.428	0.99
99_I	103_Q	1.417	0.99
23_L	46_L	1.398	0.99
147_M	150_Q	1.389	0.99
107_Q	110_K	1.384	0.99
146_A	150_Q	1.349	0.99
145_T	155_S	1.343	0.99
38_V	139_Y	1.340	0.99
15_A	158_T	1.338	0.99
46_L	144_I	1.313	0.99
91_F	137_G	1.306	0.99
30_I	35_I	1.299	0.99
57_I	94_L	1.298	0.99
24_K	85_E	1.298	0.99
51_L	75_L	1.290	0.99
26_L	148_L	1.287	0.99
16_N	91_F	1.285	0.99
10_E	99_I	1.255	0.98
13_V	99_I	1.236	0.98
28_K	43_S	1.225	0.98
19_I	46_L	1.188	0.97
76_K	80_E	1.168	0.97
116_N	122_M	1.164	0.97
7_K	128_E	1.100	0.96
82_K	86_E	1.098	0.96
114_I	161_G	1.097	0.96
145_T	156_A	1.090	0.96
23_L	42_I	1.088	0.96
59_V	117_P	1.087	0.96
31_Y	84_I	1.080	0.96
24_K	27_P	1.073	0.95
21_N	88_E	1.067	0.95
129_L	161_G	1.058	0.95
17_Q	92_L	1.051	0.95
40_P	44_H	1.039	0.95
114_I	117_P	1.029	0.94
14_W	163_Y	1.004	0.93
143_N	159_D	1.003	0.93
90_L	93_R	0.998	0.93
86_E	89_D	0.991	0.93
17_Q	21_N	0.982	0.93
12_N	16_N	0.974	0.92
112_L	126_V	0.973	0.92
12_N	98_Y	0.969	0.92
136_H	140_H	0.960	0.92
21_N	25_E	0.958	0.92
85_E	89_D	0.945	0.91
9_Y	95_S	0.943	0.91
116_N	119_S	0.939	0.91
61_S	97_R	0.939	0.91
134_V	137_G	0.937	0.91
21_N	24_K	0.936	0.91
109_N	127_S	0.931	0.91
43_S	84_I	0.913	0.90
15_A	163_Y	0.912	0.90
91_F	98_Y	0.910	0.90
53_D	137_G	0.906	0.89
61_S	64_T	0.905	0.89
100_L	104_Q	0.903	0.89
128_E	160_Y	0.899	0.89
118_S	161_G	0.899	0.89
11_Y	138_T	0.881	0.88
30_I	151_A	0.879	0.88
35_I	150_Q	0.878	0.88
83_E	89_D	0.874	0.88
20_F	87_M	0.874	0.88
54_L	94_L	0.874	0.88
147_M	154_A	0.872	0.88
149_R	155_S	0.870	0.87
51_L	55_G	0.868	0.87
56_W	132_H	0.862	0.87
13_V	96_E	0.861	0.87
60_F	101_F	0.857	0.87
50_Y	94_L	0.855	0.87
15_A	156_A	0.845	0.86
89_D	93_R	0.841	0.86
16_N	137_G	0.837	0.85
37_S	146_A	0.825	0.85
81_A	90_L	0.824	0.84
125_T	128_E	0.821	0.84
23_L	139_Y	0.815	0.84
129_L	133_V	0.812	0.84
127_S	131_P	0.809	0.83
5_A	101_F	0.809	0.83
148_L	153_Y	0.809	0.83
26_L	30_I	0.806	0.83
15_A	18_Q	0.806	0.83
139_Y	143_N	0.803	0.83
55_G	117_P	0.802	0.83
58_E	66_S	0.801	0.83
139_Y	158_T	0.801	0.83
124_T	161_G	0.794	0.82
53_D	91_F	0.783	0.81
13_V	95_S	0.782	0.81
20_F	91_F	0.780	0.81
118_S	121_I	0.775	0.81
12_N	53_D	0.772	0.80
145_T	158_T	0.771	0.80
95_S	137_G	0.770	0.80
60_F	133_V	0.769	0.80
50_Y	143_N	0.768	0.80
96_E	99_I	0.761	0.79
22_R	148_L	0.757	0.79
157_P	162_L	0.757	0.79
56_W	161_G	0.753	0.79
101_F	130_L	0.743	0.78
92_L	103_Q	0.738	0.77
118_S	122_M	0.726	0.76
54_L	90_L	0.724	0.76
93_R	96_E	0.718	0.75
30_I	153_Y	0.717	0.75
9_Y	12_N	0.714	0.75
95_S	98_Y	0.711	0.75
30_I	42_I	0.705	0.74
45_V	156_A	0.705	0.74
25_E	109_N	0.703	0.74
102_L	130_L	0.699	0.73
132_H	160_Y	0.699	0.73
20_F	88_E	0.697	0.73
52_S	60_F	0.693	0.73
19_I	144_I	0.681	0.71
35_I	40_P	0.679	0.71
47_S	87_M	0.671	0.70
14_W	141_R	0.671	0.70
59_V	116_N	0.670	0.70
92_L	96_E	0.667	0.70
32_H	83_E	0.664	0.70
53_D	95_S	0.661	0.69
32_H	104_Q	0.658	0.69
107_Q	126_V	0.656	0.69
48_H	140_H	0.655	0.68
20_F	46_L	0.653	0.68
52_S	129_L	0.649	0.68
139_Y	145_T	0.648	0.68
17_Q	106_E	0.644	0.67
39_F	141_R	0.644	0.67
7_K	84_I	0.631	0.66
45_V	143_N	0.630	0.66
42_I	151_A	0.630	0.66
145_T	149_R	0.624	0.65
60_F	98_Y	0.622	0.65
55_G	161_G	0.618	0.64
5_A	8_L	0.615	0.64
39_F	142_G	0.614	0.64
114_I	119_S	0.613	0.63
114_I	122_M	0.610	0.63
38_V	146_A	0.608	0.63
38_V	143_N	0.604	0.62
101_F	126_V	0.604	0.62
25_E	104_Q	0.603	0.62
38_V	149_R	0.600	0.62
137_G	145_T	0.599	0.62
98_Y	137_G	0.594	0.61
56_W	157_P	0.590	0.60
16_N	57_I	0.587	0.60
143_N	146_A	0.586	0.60
27_P	31_Y	0.585	0.60
20_F	23_L	0.584	0.60
28_K	31_Y	0.583	0.60
59_V	119_S	0.579	0.59
63_K	97_R	0.578	0.59
46_L	132_H	0.572	0.58
142_G	147_M	0.571	0.58
129_L	132_H	0.571	0.58
144_I	147_M	0.561	0.57
9_Y	137_G	0.558	0.56
15_A	147_M	0.556	0.56
86_E	106_E	0.556	0.56
92_L	100_L	0.553	0.56
122_M	161_G	0.551	0.55
76_K	130_L	0.547	0.55
25_E	133_V	0.544	0.54
119_S	122_M	0.542	0.54
29_E	83_E	0.540	0.54
5_A	102_L	0.539	0.54
112_L	118_S	0.538	0.54
7_K	96_E	0.535	0.53
135_N	158_T	0.532	0.53
44_H	51_L	0.530	0.52
37_S	150_Q	0.527	0.52
19_I	156_A	0.526	0.52
8_L	30_I	0.524	0.52
33_Q	150_Q	0.524	0.52
137_G	143_N	0.523	0.52
28_K	88_E	0.521	0.51
9_Y	102_L	0.521	0.51
7_K	163_Y	0.520	0.51
38_V	95_S	0.520	0.51
9_Y	91_F	0.519	0.51
8_L	134_V	0.518	0.51
12_N	91_F	0.516	0.51
115_Q	118_S	0.515	0.50
138_T	141_R	0.511	0.50
17_Q	88_E	0.511	0.50
39_F	140_H	0.507	0.49
111_P	125_T	0.507	0.49
23_L	84_I	0.501	0.49
22_R	26_L	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qe9A	2	0.936	99.9	0.482	Contact Map
3di5A	1	0.8547	99.8	0.592	Contact Map
2rd9A	4	0.9419	99.8	0.597	Contact Map
2p1aA	2	0.8198	99.8	0.599	Contact Map
2ou6A	2	0.8314	99.8	0.603	Contact Map
3gorA	2	0.8721	99.8	0.608	Contact Map
2hkvA	2	0.843	99.8	0.608	Contact Map
3dkaA	2	0.8547	99.8	0.619	Contact Map
2f22A	2	0.8314	99.8	0.619	Contact Map
3cexA	2	0.8721	99.7	0.636	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.