MISCA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MISCA - Membrane protein insertase MisCA

UniProt:	Q01625	Sequences: MLLKRRIGLLLSMVGVFMLLAGCSSVKEPITADSPHFWDKYVVYPLSELITYVAKLTGDNYGLSIILVTILIRLLILPLMIKQLRSSKAMQALQPEMQKLKEKYSSKDQKTQQKLQQETMALFQKHGVNPLAGCFPILIQMPILIGFYHAIMRTQAISEHSFLWFDLGEKDPYYILPIVAGVATFVQQKLMMAGNAQQNPQMAMMLWIMPIMIIVFAINFPAALSLYWVVGNLFMIAQTFLIKGPDIKKNPEPQKAGGKKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	261 (209)
Sequences:	4513 (2938)
Seq/√Len:	203.2

ECOLI - YIDC
BACSU - MISCA MISCB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
181_G	214_I	3.925	1.00
121_A	125_K	3.760	1.00
98_Q	101_K	3.741	1.00
118_E	121_A	3.710	1.00
96_E	99_K	3.537	1.00
94_Q	98_Q	2.933	1.00
183_A	232_N	2.791	1.00
48_E	52_Y	2.752	1.00
100_L	115_L	2.702	1.00
98_Q	102_E	2.675	1.00
113_Q	117_Q	2.440	1.00
164_W	171_D	2.439	1.00
96_E	125_K	2.410	1.00
114_K	118_E	2.377	1.00
41_Y	45_P	2.334	1.00
114_K	117_Q	2.300	1.00
66_I	230_V	2.272	1.00
96_E	126_H	2.236	1.00
148_Y	152_M	2.180	1.00
141_M	145_I	2.161	1.00
57_T	67_L	2.142	1.00
115_L	119_T	2.094	1.00
74_L	234_F	2.017	1.00
179_V	229_V	2.002	1.00
97_M	119_T	1.984	1.00
93_L	128_V	1.904	1.00
93_L	122_L	1.893	1.00
166_D	169_E	1.876	1.00
77_L	81_I	1.824	1.00
212_M	216_F	1.808	1.00
101_K	105_S	1.793	1.00
101_K	115_L	1.723	1.00
145_I	149_H	1.690	1.00
189_K	207_W	1.643	1.00
117_Q	121_A	1.641	1.00
65_I	223_A	1.607	1.00
100_L	122_L	1.567	1.00
174_Y	177_P	1.562	1.00
187_Q	236_I	1.558	1.00
81_I	85_R	1.515	1.00
103_K	118_E	1.505	1.00
89_A	92_A	1.490	1.00
119_T	123_F	1.473	1.00
203_A	207_W	1.460	1.00
138_L	142_P	1.447	1.00
174_Y	218_I	1.435	1.00
237_A	241_L	1.432	1.00
185_F	189_K	1.432	1.00
116_Q	120_M	1.408	1.00
99_K	103_K	1.394	1.00
53_V	67_L	1.391	1.00
149_H	152_M	1.378	1.00
204_M	208_I	1.367	1.00
54_A	61_Y	1.363	1.00
99_K	102_E	1.357	1.00
88_K	91_Q	1.353	1.00
116_Q	119_T	1.353	1.00
63_L	66_I	1.349	1.00
149_H	153_R	1.336	1.00
241_L	245_P	1.314	1.00
63_L	67_L	1.298	1.00
52_Y	56_L	1.271	1.00
51_T	55_K	1.271	1.00
185_F	207_W	1.266	1.00
162_F	165_F	1.259	1.00
73_R	235_M	1.255	1.00
102_E	105_S	1.251	1.00
204_M	207_W	1.250	1.00
182_V	186_V	1.233	1.00
97_M	122_L	1.228	1.00
74_L	77_L	1.219	1.00
82_K	85_R	1.203	1.00
112_Q	116_Q	1.197	1.00
83_Q	87_S	1.197	1.00
215_V	219_N	1.189	1.00
189_K	193_A	1.180	1.00
171_D	177_P	1.180	1.00
76_I	143_I	1.165	1.00
178_I	182_V	1.151	1.00
200_P	203_A	1.143	1.00
137_I	141_M	1.140	1.00
214_I	218_I	1.138	1.00
217_A	225_S	1.120	1.00
209_M	212_M	1.115	1.00
105_S	115_L	1.110	1.00
85_R	89_A	1.105	1.00
62_G	162_F	1.099	1.00
201_Q	204_M	1.099	1.00
53_V	71_L	1.097	1.00
187_Q	235_M	1.092	1.00
54_A	64_S	1.083	1.00
71_L	75_L	1.069	1.00
240_F	244_G	1.068	1.00
104_Y	107_K	1.068	1.00
73_R	238_Q	1.056	1.00
200_P	204_M	1.049	1.00
107_K	114_K	1.037	1.00
233_L	237_A	1.036	1.00
164_W	222_A	1.019	1.00
155_Q	158_S	1.017	1.00
237_A	240_F	1.009	1.00
179_V	183_A	1.004	1.00
121_A	124_Q	1.002	1.00
104_Y	114_K	0.999	1.00
171_D	174_Y	0.998	1.00
47_S	154_T	0.988	1.00
50_I	64_S	0.985	1.00
164_W	172_P	0.978	1.00
176_L	222_A	0.962	0.99
183_A	229_V	0.961	0.99
52_Y	55_K	0.960	0.99
69_T	231_G	0.959	0.99
211_I	215_V	0.956	0.99
190_L	240_F	0.955	0.99
89_A	126_H	0.954	0.99
66_I	226_L	0.952	0.99
231_G	235_M	0.949	0.99
105_S	112_Q	0.947	0.99
154_T	157_I	0.945	0.99
232_N	235_M	0.941	0.99
161_S	164_W	0.930	0.99
201_Q	205_M	0.926	0.99
208_I	212_M	0.922	0.99
120_M	124_Q	0.916	0.99
170_K	174_Y	0.914	0.99
93_L	126_H	0.914	0.99
188_Q	191_M	0.912	0.99
228_W	232_N	0.903	0.99
53_V	68_V	0.900	0.99
44_Y	48_E	0.893	0.99
92_A	126_H	0.884	0.99
62_G	226_L	0.880	0.99
39_D	45_P	0.872	0.99
38_W	41_Y	0.867	0.99
176_L	225_S	0.855	0.99
49_L	52_Y	0.847	0.99
220_F	228_W	0.842	0.99
123_F	130_P	0.841	0.99
183_A	187_Q	0.838	0.99
53_V	64_S	0.837	0.99
68_V	147_F	0.832	0.98
53_V	57_T	0.829	0.98
70_I	234_F	0.827	0.98
171_D	222_A	0.825	0.98
76_I	140_Q	0.813	0.98
70_I	230_V	0.810	0.98
40_K	44_Y	0.810	0.98
180_A	229_V	0.810	0.98
172_P	175_I	0.809	0.98
184_T	232_N	0.807	0.98
49_L	68_V	0.806	0.98
161_S	166_D	0.805	0.98
155_Q	159_E	0.798	0.98
199_N	202_M	0.796	0.98
81_I	242_I	0.790	0.98
73_R	80_M	0.785	0.98
73_R	76_I	0.783	0.98
48_E	51_T	0.782	0.98
183_A	233_L	0.782	0.98
217_A	228_W	0.772	0.98
78_P	82_K	0.772	0.98
47_S	51_T	0.772	0.98
82_K	86_S	0.770	0.98
176_L	226_L	0.767	0.97
45_P	49_L	0.763	0.97
77_L	241_L	0.759	0.97
141_M	144_L	0.757	0.97
216_F	220_F	0.756	0.97
73_R	231_G	0.756	0.97
214_I	217_A	0.754	0.97
220_F	224_L	0.754	0.97
37_F	41_Y	0.752	0.97
93_L	123_F	0.750	0.97
186_V	189_K	0.749	0.97
112_Q	115_L	0.748	0.97
88_K	92_A	0.747	0.97
245_P	248_K	0.741	0.97
87_S	90_M	0.736	0.97
191_M	194_G	0.736	0.97
107_K	113_Q	0.736	0.97
62_G	66_I	0.732	0.97
39_D	42_V	0.730	0.97
107_K	112_Q	0.727	0.96
143_I	147_F	0.719	0.96
67_L	71_L	0.718	0.96
96_E	122_L	0.717	0.96
148_Y	220_F	0.713	0.96
92_A	250_N	0.711	0.96
84_L	242_I	0.708	0.96
226_L	230_V	0.706	0.96
122_L	126_H	0.705	0.96
40_K	43_V	0.700	0.96
68_V	72_I	0.696	0.95
158_S	166_D	0.695	0.95
142_P	146_G	0.694	0.95
113_Q	116_Q	0.693	0.95
53_V	56_L	0.693	0.95
84_L	87_S	0.691	0.95
73_R	140_Q	0.691	0.95
118_E	125_K	0.689	0.95
198_Q	201_Q	0.689	0.95
176_L	229_V	0.683	0.95
129_N	134_C	0.682	0.95
193_A	196_A	0.682	0.95
144_L	235_M	0.680	0.95
139_I	142_P	0.680	0.95
49_L	71_L	0.679	0.95
115_L	118_E	0.676	0.95
83_Q	143_I	0.675	0.95
100_L	105_S	0.675	0.95
38_W	45_P	0.673	0.95
196_A	199_N	0.672	0.95
208_I	211_I	0.671	0.95
66_I	162_F	0.671	0.95
47_S	150_A	0.665	0.94
170_K	219_N	0.657	0.94
165_F	176_L	0.656	0.94
245_P	249_K	0.648	0.93
43_V	153_R	0.647	0.93
144_L	231_G	0.643	0.93
183_A	236_I	0.637	0.93
161_S	165_F	0.637	0.93
86_S	133_G	0.636	0.93
39_D	43_V	0.633	0.93
180_A	213_I	0.633	0.93
212_M	215_V	0.630	0.92
63_L	162_F	0.628	0.92
172_P	177_P	0.623	0.92
80_M	242_I	0.623	0.92
137_I	140_Q	0.621	0.92
181_G	185_F	0.620	0.92
128_V	132_A	0.618	0.92
117_Q	120_M	0.615	0.92
65_I	151_I	0.614	0.92
106_S	115_L	0.613	0.91
197_Q	203_A	0.612	0.91
101_K	123_F	0.610	0.91
81_I	84_L	0.610	0.91
158_S	168_G	0.607	0.91
104_Y	115_L	0.604	0.91
45_P	48_E	0.604	0.91
90_M	94_Q	0.602	0.91
180_A	214_I	0.599	0.90
178_I	181_G	0.598	0.90
192_M	206_L	0.597	0.90
156_A	160_H	0.595	0.90
178_I	214_I	0.591	0.90
106_S	112_Q	0.590	0.90
46_L	150_A	0.583	0.89
54_A	60_N	0.582	0.89
186_V	190_L	0.579	0.89
211_I	214_I	0.576	0.89
173_Y	177_P	0.575	0.89
72_I	147_F	0.575	0.89
57_T	63_L	0.573	0.88
185_F	206_L	0.572	0.88
229_V	233_L	0.572	0.88
84_L	88_K	0.569	0.88
41_Y	44_Y	0.569	0.88
42_V	45_P	0.569	0.88
188_Q	192_M	0.568	0.88
100_L	119_T	0.566	0.88
164_W	177_P	0.566	0.88
42_V	146_G	0.565	0.88
40_K	216_F	0.562	0.88
177_P	214_I	0.557	0.87
241_L	244_G	0.555	0.87
43_V	149_H	0.555	0.87
88_K	243_K	0.555	0.87
164_W	170_K	0.553	0.87
80_M	83_Q	0.553	0.87
157_I	168_G	0.552	0.87
166_D	171_D	0.551	0.86
76_I	83_Q	0.549	0.86
155_Q	161_S	0.543	0.86
165_F	222_A	0.543	0.86
199_N	203_A	0.541	0.85
148_Y	228_W	0.539	0.85
86_S	90_M	0.538	0.85
100_L	104_Y	0.538	0.85
55_K	170_K	0.537	0.85
80_M	84_L	0.536	0.85
72_I	227_Y	0.534	0.85
184_T	228_W	0.527	0.84
87_S	191_M	0.523	0.84
83_Q	137_I	0.522	0.83
45_P	148_Y	0.522	0.83
135_F	138_L	0.522	0.83
183_A	186_V	0.521	0.83
101_K	119_T	0.521	0.83
213_I	217_A	0.521	0.83
97_M	123_F	0.520	0.83
81_I	241_L	0.519	0.83
164_W	174_Y	0.519	0.83
220_F	225_S	0.517	0.83
93_L	97_M	0.513	0.82
187_Q	190_L	0.512	0.82
202_M	205_M	0.512	0.82
158_S	169_E	0.512	0.82
89_A	127_G	0.510	0.82
180_A	225_S	0.510	0.82
83_Q	132_A	0.509	0.82
86_S	132_A	0.509	0.82
82_K	132_A	0.508	0.82
37_F	42_V	0.508	0.82
205_M	216_F	0.507	0.82
136_P	210_P	0.506	0.82
187_Q	232_N	0.506	0.82
43_V	145_I	0.504	0.81
167_L	226_L	0.504	0.81
206_L	210_P	0.504	0.81
170_K	173_Y	0.502	0.81
113_Q	120_M	0.502	0.81
71_L	74_L	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wo6A	1	0.7969	100	0.235	Contact Map
3wvfA	1	0.8429	100	0.241	Contact Map
3vouA	4	0.4176	18.6	0.956	Contact Map
3effK	4	0.4559	16.1	0.957	Contact Map
4h33A	3	0.2835	12.8	0.959	Contact Map
3pjsK	4	0.4521	9.2	0.962	Contact Map
3rvyA	3	0.3257	8	0.962	Contact Map
4ja0A	6	0.4023	5.6	0.965	Contact Map
3blcA	4	0.1992	4.8	0.966	Contact Map
2q2fA	2	0.2184	4.2	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.