JAG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

JAG - Protein jag

UniProt:	Q01620	Sequences: MRNVTAAGRNVDEAVQSGLQELGLTKDKVEITVIEEGNKGFLGIFGKKPAIVKLVEKIDPIQQAKLYLQTIAEAIAGKSDVTVQESKKTVRYHITGEKAALLIGKRGQTLNALETLTQLALNRYPGQYKNVTVDAENYRLKRKETLSQLAIKLADQVLKTKKSIQLEPMPSSERKIIHDTLSGYANHQIKTYSMGEGENRHLVISHKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (199)
Sequences:	1159 (909)
Seq/√Len:	64.4

BACSU - JAG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_G	54_L	5.544	1.00
32_T	53_K	4.262	1.00
153_L	204_I	4.093	1.00
192_Y	205_S	3.387	1.00
24_L	56_E	3.377	1.00
143_K	147_S	3.149	1.00
19_L	29_V	2.880	1.00
6_A	21_E	2.847	1.00
165_Q	201_H	2.405	1.00
16_Q	20_Q	2.389	1.00
71_I	113_L	2.388	1.00
82_T	95_T	2.342	1.00
30_E	57_K	2.320	1.00
16_Q	26_K	2.312	1.00
111_N	170_P	2.290	1.00
181_L	191_T	2.274	1.00
34_I	51_I	2.230	1.00
5_T	51_I	2.188	1.00
15_V	31_I	2.155	1.00
24_L	29_V	2.121	1.00
64_A	92_Y	2.104	1.00
157_V	160_T	2.084	1.00
11_V	50_A	2.076	1.00
79_S	94_I	2.068	1.00
161_K	206_H	2.056	1.00
66_L	70_T	2.002	1.00
96_G	99_A	1.983	1.00
181_L	189_I	1.967	1.00
81_V	92_Y	1.925	1.00
140_L	144_E	1.880	1.00
157_V	206_H	1.850	1.00
8_G	17_S	1.834	1.00
105_K	108_Q	1.831	1.00
65_K	69_Q	1.825	1.00
114_E	172_S	1.822	1.00
113_L	133_V	1.795	1.00
64_A	117_T	1.756	1.00
5_T	53_K	1.722	0.99
11_V	37_G	1.706	0.99
15_V	52_V	1.613	0.99
24_L	28_K	1.612	0.99
29_V	54_L	1.605	0.99
25_T	28_K	1.597	0.99
144_E	147_S	1.550	0.99
151_I	180_T	1.544	0.99
67_Y	120_A	1.486	0.98
17_S	21_E	1.479	0.98
35_E	51_I	1.459	0.98
29_V	52_V	1.453	0.98
153_L	157_V	1.436	0.98
78_K	97_E	1.416	0.98
147_S	180_T	1.413	0.98
7_A	51_I	1.380	0.97
65_K	83_V	1.375	0.97
70_T	74_A	1.371	0.97
30_E	55_V	1.336	0.97
6_A	52_V	1.324	0.97
121_L	131_V	1.319	0.97
6_A	17_S	1.315	0.97
200_R	203_V	1.311	0.96
32_T	55_V	1.298	0.96
146_L	177_I	1.273	0.96
15_V	26_K	1.234	0.95
35_E	48_K	1.205	0.94
165_Q	194_M	1.203	0.94
13_E	16_Q	1.198	0.94
64_A	119_L	1.182	0.94
103_I	138_Y	1.175	0.94
4_V	21_E	1.142	0.93
198_E	201_H	1.137	0.92
6_A	22_L	1.130	0.92
106_R	142_R	1.123	0.92
82_T	93_H	1.103	0.91
85_E	129_K	1.099	0.91
108_Q	175_K	1.091	0.91
69_Q	73_E	1.086	0.91
37_G	50_A	1.081	0.90
40_G	48_K	1.067	0.90
59_D	63_Q	1.063	0.90
183_G	191_T	1.062	0.90
197_G	201_H	1.057	0.89
150_A	177_I	1.054	0.89
59_D	62_Q	1.053	0.89
188_Q	206_H	1.036	0.88
10_N	14_A	1.013	0.87
13_E	17_S	1.007	0.87
104_G	138_Y	1.007	0.87
171_S	175_K	1.000	0.87
31_I	52_V	0.991	0.86
158_L	189_I	0.989	0.86
15_V	18_G	0.985	0.86
96_G	136_E	0.984	0.86
142_R	145_T	0.983	0.86
145_T	177_I	0.961	0.84
106_R	167_E	0.958	0.84
65_K	92_Y	0.946	0.83
189_I	202_L	0.942	0.83
53_K	180_T	0.939	0.83
62_Q	66_L	0.933	0.82
69_Q	80_D	0.932	0.82
169_M	200_R	0.928	0.82
181_L	188_Q	0.925	0.82
12_D	26_K	0.924	0.82
17_S	20_Q	0.920	0.82
154_A	180_T	0.912	0.81
26_K	31_I	0.905	0.81
11_V	15_V	0.904	0.80
178_H	193_S	0.903	0.80
174_R	178_H	0.889	0.79
197_G	200_R	0.882	0.79
163_S	205_S	0.881	0.79
150_A	181_L	0.880	0.79
100_A	145_T	0.879	0.79
111_N	171_S	0.863	0.77
63_Q	66_L	0.863	0.77
142_R	167_E	0.861	0.77
43_G	48_K	0.850	0.76
149_L	167_E	0.849	0.76
9_R	13_E	0.843	0.76
144_E	148_Q	0.841	0.75
103_I	109_T	0.837	0.75
31_I	54_L	0.835	0.75
190_K	205_S	0.834	0.75
64_A	120_A	0.829	0.74
149_L	153_L	0.824	0.74
10_N	13_E	0.821	0.74
67_Y	117_T	0.821	0.74
63_Q	124_Y	0.818	0.73
19_L	31_I	0.817	0.73
43_G	50_A	0.808	0.72
114_E	139_R	0.805	0.72
134_D	140_L	0.805	0.72
19_L	26_K	0.802	0.72
163_S	206_H	0.800	0.72
137_N	140_L	0.792	0.71
99_A	135_A	0.789	0.71
40_G	46_G	0.788	0.71
69_Q	92_Y	0.787	0.70
90_V	176_I	0.778	0.70
64_A	83_V	0.776	0.69
80_D	95_T	0.773	0.69
37_G	40_G	0.769	0.69
174_R	193_S	0.766	0.68
118_Q	182_S	0.759	0.68
120_A	137_N	0.757	0.67
4_V	29_V	0.756	0.67
104_G	107_G	0.753	0.67
112_A	128_Y	0.752	0.67
39_K	46_G	0.749	0.67
153_L	164_I	0.745	0.66
179_D	182_S	0.743	0.66
95_T	136_E	0.741	0.66
154_A	189_I	0.741	0.66
111_N	114_E	0.741	0.66
72_A	76_A	0.740	0.66
99_A	202_L	0.737	0.65
106_R	145_T	0.733	0.65
34_I	53_K	0.732	0.65
166_L	177_I	0.730	0.65
189_I	206_H	0.726	0.64
98_K	101_L	0.726	0.64
15_V	19_L	0.722	0.64
7_A	49_P	0.715	0.63
81_V	133_V	0.715	0.63
65_K	82_T	0.715	0.63
149_L	177_I	0.714	0.63
170_P	175_K	0.709	0.62
61_I	65_K	0.708	0.62
58_I	61_I	0.706	0.62
134_D	137_N	0.703	0.62
153_L	166_L	0.702	0.62
43_G	46_G	0.702	0.62
18_G	22_L	0.696	0.61
28_K	59_D	0.695	0.61
24_L	88_K	0.693	0.61
119_L	167_E	0.692	0.61
64_A	90_V	0.692	0.61
63_Q	121_L	0.692	0.61
72_A	102_L	0.686	0.60
66_L	86_S	0.679	0.59
166_L	169_M	0.675	0.59
110_L	156_Q	0.672	0.58
147_S	151_I	0.671	0.58
163_S	196_E	0.671	0.58
40_G	43_G	0.667	0.58
83_V	90_V	0.662	0.57
70_T	73_E	0.661	0.57
100_A	138_Y	0.660	0.57
194_M	201_H	0.659	0.57
84_Q	91_R	0.657	0.57
18_G	52_V	0.656	0.56
111_N	175_K	0.656	0.56
15_V	54_L	0.654	0.56
36_E	64_A	0.651	0.56
142_R	173_E	0.647	0.55
19_L	54_L	0.647	0.55
121_L	124_Y	0.645	0.55
65_K	90_V	0.644	0.55
67_Y	71_I	0.644	0.55
120_A	123_R	0.642	0.55
148_Q	152_K	0.641	0.55
143_K	176_I	0.641	0.55
175_K	179_D	0.639	0.54
115_T	119_L	0.637	0.54
157_V	164_I	0.637	0.54
111_N	139_R	0.635	0.54
66_L	83_V	0.634	0.54
18_G	29_V	0.627	0.53
17_S	97_E	0.626	0.53
21_E	85_E	0.626	0.53
81_V	135_A	0.622	0.53
27_D	83_V	0.620	0.52
192_Y	203_V	0.620	0.52
163_S	194_M	0.616	0.52
102_L	153_L	0.616	0.52
94_I	133_V	0.615	0.52
180_T	189_I	0.615	0.52
43_G	47_K	0.614	0.52
136_E	141_K	0.612	0.51
159_K	162_K	0.612	0.51
149_L	169_M	0.611	0.51
72_A	79_S	0.610	0.51
67_Y	191_T	0.610	0.51
67_Y	116_L	0.608	0.51
106_R	149_L	0.606	0.51
74_A	166_L	0.603	0.50
86_S	154_A	0.601	0.50
158_L	175_K	0.597	0.50
171_S	206_H	0.595	0.49
102_L	135_A	0.593	0.49
135_A	175_K	0.590	0.49
122_N	125_P	0.589	0.49
154_A	181_L	0.587	0.48
38_N	47_K	0.587	0.48
156_Q	167_E	0.585	0.48
67_Y	182_S	0.584	0.48
86_S	89_T	0.582	0.48
67_Y	170_P	0.578	0.47
73_E	78_K	0.578	0.47
59_D	85_E	0.575	0.47
12_D	16_Q	0.574	0.47
119_L	139_R	0.572	0.47
183_G	187_H	0.571	0.47
5_T	32_T	0.570	0.46
83_V	92_Y	0.570	0.46
71_I	76_A	0.570	0.46
17_S	66_L	0.568	0.46
41_F	59_D	0.567	0.46
109_T	169_M	0.565	0.46
145_T	167_E	0.563	0.46
100_A	103_I	0.562	0.46
42_L	169_M	0.561	0.45
158_L	188_Q	0.561	0.45
114_E	132_T	0.560	0.45
106_R	128_Y	0.560	0.45
117_T	120_A	0.559	0.45
72_A	98_K	0.557	0.45
49_P	119_L	0.556	0.45
58_I	63_Q	0.556	0.45
68_L	120_A	0.555	0.45
41_F	44_I	0.552	0.44
164_I	191_T	0.552	0.44
12_D	47_K	0.551	0.44
59_D	176_I	0.549	0.44
18_G	87_K	0.548	0.44
6_A	29_V	0.547	0.44
43_G	105_K	0.545	0.44
14_A	18_G	0.545	0.44
175_K	199_N	0.542	0.43
40_G	47_K	0.540	0.43
160_T	164_I	0.540	0.43
63_Q	144_E	0.536	0.43
84_Q	133_V	0.534	0.42
118_Q	121_L	0.533	0.42
21_E	66_L	0.532	0.42
110_L	171_S	0.532	0.42
99_A	102_L	0.530	0.42
105_K	160_T	0.530	0.42
34_I	39_K	0.528	0.42
33_V	43_G	0.527	0.42
86_S	91_R	0.524	0.41
22_L	54_L	0.522	0.41
17_S	53_K	0.517	0.40
69_Q	94_I	0.516	0.40
141_K	194_M	0.515	0.40
68_L	72_A	0.514	0.40
16_Q	187_H	0.512	0.40
40_G	50_A	0.512	0.40
178_H	191_T	0.512	0.40
165_Q	172_S	0.511	0.40
103_I	107_G	0.509	0.40
30_E	170_P	0.507	0.39
103_I	131_V	0.504	0.39
52_V	74_A	0.502	0.39
121_L	167_E	0.501	0.39
115_T	118_Q	0.501	0.39
92_Y	133_V	0.501	0.39
81_V	94_I	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gkuA	2	0.976	100	0.084	Contact Map
2pt7G	2	0.6683	100	0.438	Contact Map
2cpmA	1	0.3462	99.7	0.741	Contact Map
1mszA	1	0.2933	99.3	0.797	Contact Map
1whrA	1	0.4327	97	0.893	Contact Map
1wh9A	1	0.4423	91.6	0.921	Contact Map
4qmfD	1	0.7115	86.5	0.929	Contact Map
3zeyX	1	0.7019	85.8	0.929	Contact Map
4ujpE	1	0.7115	85.7	0.93	Contact Map
3j20C	1	0.6923	82	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.