SP3AB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP3AB - Stage III sporulation protein AB

UniProt:	Q01368	Sequences: MLKLLGAVFIVVATTWTGFEMAKIYTERPRQIRQLRAALQSLEAEIMYGHTPLHTASQQIAKQLAQPVSTLFSAFSDQLDKGSDSAKTAWEQSLKKVWDTLSLKKSEYEVLKQFGETLGIHDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSLGFLAGLLLILLLM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (169)
Sequences:	509 (452)
Seq/√Len:	34.7

BACSU - SP3AB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_L	56_A	5.757	1.00
90_W	115_G	4.902	1.00
38_A	72_F	3.184	1.00
28_R	107_E	2.972	1.00
11_V	167_I	2.588	1.00
36_R	138_E	2.552	1.00
148_Q	152_E	2.476	1.00
44_A	121_H	2.417	1.00
146_Q	150_K	2.387	1.00
44_A	125_S	2.382	1.00
7_A	167_I	2.265	0.99
78_Q	92_Q	2.248	0.99
119_G	126_Q	2.202	0.99
89_A	93_S	2.127	0.99
43_E	131_K	2.056	0.98
14_T	163_G	2.037	0.98
6_G	13_A	1.955	0.98
85_S	88_T	1.953	0.98
53_L	56_A	1.903	0.97
33_R	145_E	1.816	0.97
78_Q	93_S	1.801	0.96
121_H	125_S	1.729	0.96
6_G	9_F	1.705	0.95
135_T	138_E	1.702	0.95
61_A	73_S	1.672	0.95
33_R	43_E	1.666	0.95
32_I	107_E	1.627	0.94
47_M	127_Q	1.613	0.94
157_S	161_L	1.595	0.93
98_W	101_L	1.530	0.92
36_R	141_E	1.524	0.91
57_S	75_F	1.511	0.91
11_V	164_L	1.503	0.91
107_E	140_S	1.491	0.90
75_F	86_A	1.477	0.90
110_V	133_A	1.471	0.90
28_R	159_G	1.459	0.89
38_A	43_E	1.445	0.89
86_A	89_A	1.416	0.88
43_E	128_K	1.377	0.87
98_W	107_E	1.373	0.86
27_E	30_R	1.373	0.86
91_E	112_K	1.356	0.86
71_L	75_F	1.355	0.86
75_F	93_S	1.315	0.84
141_E	152_E	1.303	0.83
19_F	31_Q	1.284	0.82
28_R	144_A	1.263	0.81
31_Q	67_P	1.245	0.80
120_I	125_S	1.244	0.80
36_R	134_L	1.243	0.80
78_Q	96_K	1.242	0.80
68_V	71_L	1.241	0.80
9_F	81_K	1.227	0.79
49_G	114_F	1.209	0.78
114_F	130_I	1.208	0.78
161_L	165_L	1.208	0.78
128_K	132_L	1.196	0.78
4_L	7_A	1.191	0.77
11_V	14_T	1.186	0.77
4_L	8_V	1.151	0.75
40_Q	132_L	1.150	0.75
147_A	151_N	1.146	0.74
64_L	85_S	1.135	0.74
35_L	71_L	1.133	0.74
13_A	16_W	1.131	0.73
29_P	33_R	1.127	0.73
15_T	19_F	1.120	0.73
44_A	129_H	1.118	0.73
33_R	136_H	1.118	0.73
54_H	79_L	1.109	0.72
23_K	26_T	1.098	0.71
36_R	90_W	1.093	0.71
66_Q	70_T	1.091	0.71
115_G	164_L	1.078	0.70
153_K	169_L	1.074	0.70
91_E	95_K	1.070	0.69
74_A	96_K	1.068	0.69
32_I	103_L	1.066	0.69
125_S	129_H	1.059	0.68
51_T	54_H	1.056	0.68
105_K	147_A	1.050	0.68
22_A	118_L	1.026	0.66
39_L	90_W	1.016	0.65
26_T	148_Q	1.016	0.65
139_A	143_D	1.014	0.65
68_V	72_F	1.008	0.65
66_Q	69_S	0.999	0.64
61_A	69_S	0.991	0.63
95_K	108_Y	0.980	0.62
95_K	112_K	0.977	0.62
38_A	117_T	0.975	0.62
13_A	103_L	0.958	0.61
130_I	134_L	0.953	0.60
73_S	77_D	0.952	0.60
63_Q	110_V	0.950	0.60
2_L	109_E	0.947	0.60
72_F	86_A	0.946	0.60
88_T	92_Q	0.940	0.59
21_M	41_S	0.940	0.59
15_T	167_I	0.919	0.57
14_T	73_S	0.913	0.57
76_S	80_D	0.913	0.57
58_Q	80_D	0.900	0.56
151_N	154_M	0.899	0.56
111_L	135_T	0.896	0.55
42_L	123_R	0.896	0.55
43_E	134_L	0.894	0.55
165_L	169_L	0.893	0.55
50_H	123_R	0.893	0.55
22_A	159_G	0.887	0.55
137_L	170_L	0.881	0.54
34_Q	37_A	0.875	0.54
2_L	92_Q	0.874	0.54
15_T	118_L	0.872	0.53
51_T	56_A	0.871	0.53
15_T	159_G	0.868	0.53
164_L	168_L	0.867	0.53
72_F	118_L	0.861	0.52
79_L	135_T	0.855	0.52
90_W	111_L	0.851	0.52
152_E	161_L	0.847	0.51
34_Q	68_V	0.834	0.50
10_I	66_Q	0.821	0.49
49_G	107_E	0.820	0.49
103_L	138_E	0.816	0.49
29_P	141_E	0.815	0.48
69_S	102_S	0.811	0.48
74_A	78_Q	0.804	0.48
75_F	89_A	0.801	0.47
136_H	139_A	0.798	0.47
27_E	31_Q	0.796	0.47
85_S	154_M	0.794	0.47
53_L	86_A	0.793	0.47
103_L	108_Y	0.792	0.47
52_P	158_L	0.792	0.47
42_L	53_L	0.790	0.46
18_G	119_G	0.782	0.46
15_T	32_I	0.779	0.45
70_T	100_T	0.774	0.45
152_E	156_K	0.772	0.45
53_L	57_S	0.766	0.44
138_E	150_K	0.766	0.44
119_G	159_G	0.765	0.44
37_A	139_A	0.759	0.44
88_T	95_K	0.758	0.44
36_R	148_Q	0.758	0.44
75_F	78_Q	0.748	0.43
86_A	90_W	0.746	0.43
24_I	61_A	0.740	0.42
11_V	140_S	0.724	0.41
147_A	150_K	0.723	0.41
114_F	150_K	0.722	0.41
2_L	8_V	0.720	0.40
87_K	94_L	0.718	0.40
90_W	136_H	0.716	0.40
124_I	127_Q	0.716	0.40
94_L	111_L	0.715	0.40
16_W	63_Q	0.711	0.40
18_G	126_Q	0.700	0.39
13_A	68_V	0.695	0.38
4_L	101_L	0.695	0.38
63_Q	139_A	0.694	0.38
110_V	140_S	0.693	0.38
55_T	95_K	0.690	0.38
74_A	104_K	0.689	0.38
73_S	80_D	0.683	0.37
83_S	135_T	0.682	0.37
137_L	146_Q	0.680	0.37
88_T	169_L	0.678	0.37
106_S	140_S	0.674	0.37
45_E	59_Q	0.669	0.36
56_A	110_V	0.668	0.36
44_A	165_L	0.667	0.36
49_G	167_I	0.667	0.36
11_V	99_D	0.660	0.36
38_A	68_V	0.655	0.35
98_W	108_Y	0.651	0.35
125_S	155_I	0.650	0.35
59_Q	145_E	0.649	0.35
56_A	166_L	0.643	0.34
155_I	169_L	0.642	0.34
6_G	45_E	0.629	0.33
95_K	167_I	0.628	0.33
21_M	155_I	0.625	0.33
121_H	126_Q	0.624	0.33
116_E	140_S	0.612	0.32
9_F	46_I	0.612	0.32
39_L	114_F	0.611	0.32
84_D	89_A	0.610	0.32
100_T	112_K	0.608	0.32
41_S	164_L	0.605	0.31
114_F	168_L	0.600	0.31
49_G	141_E	0.595	0.31
12_V	62_K	0.595	0.31
2_L	30_R	0.591	0.30
13_A	90_W	0.590	0.30
77_D	94_L	0.590	0.30
69_S	79_L	0.588	0.30
83_S	105_K	0.581	0.30
28_R	32_I	0.581	0.30
17_T	160_F	0.581	0.30
36_R	122_D	0.580	0.30
97_V	168_L	0.579	0.30
31_Q	102_S	0.578	0.30
52_P	123_R	0.578	0.30
29_P	144_A	0.577	0.29
76_S	146_Q	0.577	0.29
19_F	51_T	0.574	0.29
45_E	60_I	0.569	0.29
33_R	166_L	0.568	0.29
3_K	73_S	0.568	0.29
78_Q	170_L	0.567	0.29
46_I	126_Q	0.566	0.29
107_E	144_A	0.564	0.29
29_P	36_R	0.562	0.28
93_S	101_L	0.561	0.28
116_E	170_L	0.559	0.28
3_K	39_L	0.558	0.28
51_T	61_A	0.554	0.28
16_W	127_Q	0.550	0.28
151_N	165_L	0.547	0.27
114_F	124_I	0.545	0.27
131_K	142_A	0.543	0.27
59_Q	168_L	0.541	0.27
4_L	11_V	0.539	0.27
9_F	36_R	0.538	0.27
35_L	101_L	0.531	0.26
4_L	19_F	0.530	0.26
34_Q	65_A	0.529	0.26
99_D	166_L	0.527	0.26
81_K	133_A	0.527	0.26
116_E	120_I	0.527	0.26
72_F	154_M	0.526	0.26
86_A	165_L	0.526	0.26
118_L	132_L	0.525	0.26
9_F	104_K	0.524	0.26
40_Q	43_E	0.523	0.26
141_E	161_L	0.522	0.26
113_Q	161_L	0.521	0.26
63_Q	103_L	0.520	0.26
98_W	103_L	0.518	0.25
58_Q	76_S	0.515	0.25
163_G	170_L	0.512	0.25
19_F	159_G	0.510	0.25
110_V	144_A	0.510	0.25
61_A	109_E	0.509	0.25
77_D	108_Y	0.508	0.25
95_K	145_E	0.507	0.25
54_H	107_E	0.506	0.25
2_L	24_I	0.506	0.25
154_M	159_G	0.505	0.25
49_G	128_K	0.502	0.24
101_L	167_I	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ykeB	1	0.6784	17.8	0.935	Contact Map
2jxuA	1	0.7485	17	0.936	Contact Map
4hkrA	3	0.2807	14.8	0.937	Contact Map
2whnA	1	0.6374	13.7	0.938	Contact Map
2j69A	1	0.7544	10.8	0.941	Contact Map
3c1qA	2	0.6901	7.1	0.946	Contact Map
4hhxA	1	0.5731	6.9	0.946	Contact Map
1ykhB	1	0.6608	6.3	0.947	Contact Map
1gotG	1	0.3275	5.7	0.948	Contact Map
4cq4A	4	0.4854	5.4	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.