CAPC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CAPC - PGA biosynthesis protein CapC

UniProt:	P96737	Sequences: MFGSDLYIALILGVLLSLIFAEKTGIVPAGLVVPGYLGLVFNQPVFILLVLLVSLLTYVIVKYGLSKFMILYGRRKFAAMLITGIVLKIAFDFLYPIVPFEIAEFRGIGIIVPGLIANTIQKQGLTITFGSTLLLSGATFAIMFVYYLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (137)
Sequences:	194 (137)
Seq/√Len:	11.7

BACSU - CAPC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
113_P	128_T	2.850	0.94
77_F	118_N	2.643	0.91
59_V	64_G	2.630	0.91
52_L	56_L	2.496	0.88
76_K	107_G	2.492	0.88
29_A	128_T	2.389	0.86
25_G	115_L	2.302	0.83
58_Y	116_I	2.268	0.82
16_L	41_F	2.195	0.80
61_V	80_M	2.106	0.77
105_F	118_N	2.028	0.75
111_I	115_L	1.882	0.69
19_I	52_L	1.866	0.68
59_V	141_A	1.864	0.68
48_L	84_G	1.826	0.66
23_K	81_L	1.824	0.66
73_G	117_A	1.819	0.66
82_I	143_M	1.817	0.66
86_V	89_I	1.803	0.65
29_A	113_P	1.800	0.65
17_S	84_G	1.790	0.65
120_I	129_F	1.782	0.64
47_I	94_L	1.779	0.64
21_A	32_V	1.700	0.60
88_K	107_G	1.645	0.58
9_A	143_M	1.618	0.57
22_E	108_I	1.604	0.56
51_L	129_F	1.603	0.56
65_L	69_M	1.591	0.55
50_V	108_I	1.547	0.53
11_I	93_F	1.509	0.51
33_V	36_Y	1.505	0.51
31_L	110_I	1.500	0.51
76_K	112_V	1.500	0.51
22_E	33_V	1.492	0.50
37_L	136_S	1.488	0.50
64_G	68_F	1.487	0.50
97_I	100_F	1.443	0.48
73_G	115_L	1.418	0.47
13_G	109_G	1.371	0.44
35_G	124_G	1.335	0.43
35_G	116_I	1.298	0.41
10_L	17_S	1.279	0.40
123_Q	128_T	1.269	0.39
60_I	64_G	1.254	0.39
113_P	123_Q	1.242	0.38
86_V	133_L	1.241	0.38
60_I	67_K	1.226	0.37
62_K	83_T	1.223	0.37
48_L	83_T	1.220	0.37
61_V	83_T	1.213	0.37
87_L	131_S	1.201	0.36
89_I	133_L	1.191	0.36
7_Y	88_K	1.183	0.35
64_G	142_I	1.178	0.35
71_L	79_A	1.175	0.35
58_Y	77_F	1.165	0.35
48_L	56_L	1.154	0.34
127_I	132_T	1.152	0.34
56_L	97_I	1.140	0.34
34_P	109_G	1.126	0.33
114_G	123_Q	1.109	0.32
67_K	138_A	1.106	0.32
58_Y	79_A	1.102	0.32
85_I	119_T	1.098	0.32
48_L	94_L	1.091	0.31
41_F	119_T	1.083	0.31
32_V	35_G	1.059	0.30
32_V	75_R	1.036	0.29
12_L	102_I	1.022	0.29
72_Y	114_G	1.010	0.28
38_G	75_R	1.010	0.28
55_L	60_I	1.004	0.28
34_P	117_A	0.998	0.28
105_F	133_L	0.982	0.27
108_I	134_L	0.978	0.27
18_L	21_A	0.973	0.27
95_Y	100_F	0.973	0.27
65_L	125_L	0.971	0.27
29_A	139_T	0.971	0.27
28_P	131_S	0.954	0.26
33_V	108_I	0.934	0.25
116_I	131_S	0.930	0.25
86_V	129_F	0.928	0.25
78_A	139_T	0.921	0.25
54_S	112_V	0.913	0.24
52_L	98_V	0.912	0.24
8_I	81_L	0.908	0.24
13_G	72_Y	0.903	0.24
71_L	77_F	0.893	0.24
65_L	86_V	0.893	0.24
132_T	140_F	0.892	0.24
17_S	114_G	0.889	0.23
19_I	83_T	0.887	0.23
121_Q	139_T	0.882	0.23
65_L	68_F	0.874	0.23
15_L	51_L	0.869	0.23
13_G	27_V	0.868	0.23
16_L	98_V	0.840	0.22
28_P	77_F	0.838	0.22
34_P	73_G	0.836	0.22
20_F	124_G	0.815	0.21
38_G	136_S	0.813	0.21
12_L	20_F	0.809	0.21
51_L	55_L	0.808	0.21
98_V	102_I	0.794	0.20
45_V	60_I	0.791	0.20
44_P	51_L	0.789	0.20
12_L	48_L	0.788	0.20
57_T	83_T	0.786	0.20
14_V	120_I	0.785	0.20
35_G	111_I	0.784	0.20
112_V	123_Q	0.782	0.20
97_I	126_T	0.777	0.20
25_G	118_N	0.777	0.20
36_Y	108_I	0.767	0.19
75_R	114_G	0.766	0.19
26_I	53_V	0.766	0.19
31_L	117_A	0.760	0.19
60_I	83_T	0.757	0.19
52_L	90_A	0.751	0.19
74_R	92_D	0.747	0.19
16_L	93_F	0.741	0.19
15_L	52_L	0.740	0.19
51_L	67_K	0.740	0.19
52_L	126_T	0.738	0.19
22_E	119_T	0.734	0.18
130_G	138_A	0.728	0.18
41_F	136_S	0.725	0.18
12_L	133_L	0.724	0.18
50_V	85_I	0.714	0.18
28_P	72_Y	0.710	0.18
49_L	67_K	0.700	0.17
39_L	75_R	0.695	0.17
61_V	74_R	0.694	0.17
29_A	119_T	0.686	0.17
24_T	82_I	0.679	0.17
38_G	130_G	0.676	0.17
90_A	129_F	0.674	0.17
60_I	101_E	0.674	0.17
17_S	135_L	0.673	0.17
84_G	101_E	0.671	0.17
26_I	122_K	0.661	0.16
44_P	56_L	0.658	0.16
15_L	44_P	0.652	0.16
17_S	70_I	0.648	0.16
62_K	141_A	0.644	0.16
15_L	126_T	0.643	0.16
60_I	133_L	0.642	0.16
57_T	87_L	0.641	0.16
49_L	74_R	0.639	0.16
20_F	32_V	0.638	0.16
28_P	119_T	0.636	0.16
87_L	90_A	0.635	0.16
32_V	42_N	0.628	0.15
69_M	86_V	0.625	0.15
21_A	29_A	0.624	0.15
44_P	98_V	0.623	0.15
83_T	127_I	0.622	0.15
8_I	98_V	0.620	0.15
44_P	109_G	0.619	0.15
13_G	122_K	0.616	0.15
72_Y	78_A	0.610	0.15
59_V	93_F	0.606	0.15
12_L	143_M	0.606	0.15
85_I	111_I	0.604	0.15
120_I	138_A	0.602	0.15
40_V	103_A	0.601	0.15
17_S	116_I	0.599	0.15
25_G	117_A	0.597	0.15
51_L	62_K	0.597	0.15
73_G	76_K	0.596	0.15
24_T	112_V	0.595	0.15
19_I	97_I	0.593	0.15
88_K	99_P	0.589	0.14
124_G	128_T	0.589	0.14
22_E	95_Y	0.586	0.14
56_L	103_A	0.585	0.14
20_F	127_I	0.577	0.14
32_V	81_L	0.573	0.14
70_I	75_R	0.573	0.14
32_V	84_G	0.572	0.14
91_F	116_I	0.569	0.14
90_A	142_I	0.566	0.14
12_L	50_V	0.559	0.14
81_L	115_L	0.559	0.14
14_V	24_T	0.552	0.14
48_L	81_L	0.551	0.14
8_I	142_I	0.551	0.14
67_K	112_V	0.548	0.14
20_F	44_P	0.545	0.13
76_K	134_L	0.543	0.13
84_G	88_K	0.541	0.13
132_T	135_L	0.538	0.13
115_L	132_T	0.534	0.13
41_F	137_G	0.534	0.13
13_G	114_G	0.534	0.13
16_L	34_P	0.524	0.13
130_G	137_G	0.522	0.13
39_L	73_G	0.520	0.13
56_L	126_T	0.515	0.13
60_I	94_L	0.512	0.13
9_A	139_T	0.505	0.13
121_Q	132_T	0.505	0.13
58_Y	96_P	0.503	0.13
32_V	129_F	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gfpA	2	0.9329	12.4	0.936	Contact Map
4j05A	3	0.9597	4.8	0.947	Contact Map
4tphA	2	0.9463	4.8	0.947	Contact Map
3wdoA	1	0.9799	4.1	0.949	Contact Map
1pw4A	1	0.9866	3.9	0.95	Contact Map
4pypA	1	0.9396	3.3	0.951	Contact Map
3o7qA	1	0.9664	3.2	0.951	Contact Map
4gc0A	1	0.9597	2.4	0.954	Contact Map
4ldsA	2	0.9195	2.4	0.954	Contact Map
4cadC	1	0.4899	2.1	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.