YDFQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YDFQ - Thioredoxin-like protein YdfQ

UniProt:	P96695	Sequences: MKEMTGLHSLVSIENFIKQHKFSFIYISRPGCTVCHAVLPQLRIVLDQFPNIKLGHINADDVAEVAGRFSVFTVPVLLLFIDGTEFLREARFVHFEQLEQKLKRVYRLYEGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	112 (100)
Sequences:	11833 (8096)
Seq/√Len:	809.6

ECOLI - THIO2 THIO YBBN
BACSU - YDFQ BDBA YTPP THIO YDBP YUSE YNEN RESA STOA
HALSA - O46709 Q9HQ69 Q9HMD0
SULSO - Q97WI4 Q980E5 Q980T5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_A	66_A	2.511	1.00
44_I	95_F	2.463	1.00
8_H	55_G	2.151	1.00
48_Q	99_E	2.134	1.00
10_L	64_E	2.114	1.00
14_E	68_R	2.076	1.00
48_Q	95_F	2.072	1.00
94_H	97_Q	2.065	1.00
85_E	88_R	1.968	1.00
78_L	88_R	1.942	1.00
49_F	99_E	1.829	1.00
99_E	103_K	1.799	1.00
69_F	80_F	1.742	1.00
58_N	61_D	1.675	1.00
10_L	65_V	1.665	1.00
42_L	54_L	1.664	1.00
23_S	53_K	1.645	1.00
78_L	85_E	1.635	1.00
21_K	53_K	1.597	1.00
59_A	74_V	1.572	1.00
32_C	35_C	1.552	1.00
14_E	18_K	1.534	1.00
41_Q	44_I	1.532	1.00
26_Y	56_H	1.522	1.00
8_H	16_F	1.497	1.00
12_S	16_F	1.479	1.00
16_F	53_K	1.468	1.00
9_S	12_S	1.420	1.00
41_Q	95_F	1.417	1.00
97_Q	100_Q	1.404	1.00
89_E	93_V	1.402	1.00
49_F	103_K	1.395	1.00
87_L	101_K	1.375	1.00
30_P	58_N	1.372	1.00
10_L	62_V	1.365	1.00
45_V	54_L	1.319	1.00
24_F	42_L	1.318	1.00
6_G	16_F	1.310	1.00
24_F	77_L	1.294	1.00
95_F	99_E	1.288	1.00
22_F	79_L	1.277	1.00
45_V	99_E	1.276	1.00
38_V	77_L	1.261	1.00
89_E	101_K	1.223	1.00
23_S	55_G	1.218	1.00
92_F	97_Q	1.194	1.00
6_G	53_K	1.113	1.00
45_V	95_F	1.103	1.00
87_L	105_V	1.067	1.00
79_L	105_V	1.050	1.00
26_Y	39_L	1.049	1.00
9_S	62_V	1.029	1.00
16_F	23_S	1.029	1.00
57_I	65_V	1.024	1.00
63_A	67_G	1.023	1.00
39_L	43_R	1.010	1.00
93_V	97_Q	1.005	1.00
38_V	41_Q	0.995	1.00
79_L	101_K	0.975	1.00
25_I	80_F	0.975	1.00
39_L	56_H	0.974	1.00
22_F	81_I	0.962	1.00
28_S	56_H	0.961	1.00
45_V	49_F	0.932	1.00
7_L	56_H	0.918	1.00
27_I	69_F	0.891	1.00
81_I	86_F	0.889	1.00
43_R	56_H	0.875	1.00
37_A	92_F	0.873	1.00
77_L	98_L	0.871	1.00
38_V	98_L	0.837	1.00
64_E	68_R	0.834	1.00
42_L	77_L	0.828	1.00
17_I	23_S	0.827	1.00
41_Q	94_H	0.813	1.00
52_I	102_L	0.805	1.00
27_I	71_V	0.793	1.00
100_Q	103_K	0.793	1.00
13_I	17_I	0.786	1.00
79_L	102_L	0.785	1.00
38_V	93_V	0.783	1.00
30_P	60_D	0.772	1.00
15_N	18_K	0.760	1.00
101_K	105_V	0.758	1.00
46_L	54_L	0.750	1.00
57_I	66_A	0.749	1.00
7_L	61_D	0.748	1.00
27_I	59_A	0.743	1.00
8_H	12_S	0.742	1.00
12_S	55_G	0.739	1.00
28_S	58_N	0.729	1.00
24_F	54_L	0.729	1.00
45_V	98_L	0.726	1.00
27_I	78_L	0.722	1.00
96_E	100_Q	0.714	1.00
20_H	82_D	0.713	1.00
93_V	101_K	0.709	1.00
49_F	52_I	0.708	1.00
33_T	36_H	0.701	1.00
12_S	15_N	0.691	1.00
21_K	82_D	0.689	1.00
41_Q	45_V	0.686	1.00
44_I	47_D	0.683	1.00
64_E	67_G	0.681	1.00
51_N	103_K	0.679	1.00
28_S	74_V	0.675	1.00
25_I	55_G	0.671	1.00
26_Y	34_V	0.664	1.00
27_I	57_I	0.660	1.00
72_F	88_R	0.658	1.00
33_T	37_A	0.642	1.00
47_D	50_P	0.640	1.00
62_V	65_V	0.637	1.00
80_F	85_E	0.633	1.00
63_A	66_A	0.628	1.00
30_P	36_H	0.621	1.00
13_I	69_F	0.620	1.00
13_I	27_I	0.620	1.00
8_H	25_I	0.614	1.00
13_I	65_V	0.614	1.00
24_F	79_L	0.608	1.00
101_K	104_R	0.607	1.00
77_L	89_E	0.605	1.00
65_V	68_R	0.600	1.00
26_Y	38_V	0.594	1.00
20_H	23_S	0.594	1.00
16_F	19_Q	0.588	1.00
31_G	36_H	0.586	1.00
38_V	42_L	0.583	1.00
24_F	102_L	0.568	1.00
34_V	37_A	0.564	1.00
38_V	92_F	0.563	1.00
21_K	51_N	0.559	1.00
34_V	73_T	0.558	1.00
31_G	60_D	0.552	1.00
7_L	28_S	0.547	1.00
30_P	61_D	0.544	1.00
24_F	98_L	0.538	1.00
57_I	62_V	0.538	1.00
96_E	99_E	0.534	1.00
16_F	55_G	0.533	1.00
10_L	68_R	0.528	1.00
71_V	76_V	0.522	1.00
19_Q	53_K	0.517	1.00
102_L	105_V	0.515	1.00
81_I	84_T	0.514	1.00
7_L	55_G	0.509	1.00
6_G	55_G	0.504	1.00
70_S	88_R	0.501	1.00
42_L	102_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f8uA	2	0.9821	99.8	0.165	Contact Map
2r2jA	2	0.9554	99.8	0.169	Contact Map
2b5eA	1	1	99.8	0.178	Contact Map
3apoA	1	0.9286	99.8	0.185	Contact Map
4ekzA	1	1	99.8	0.204	Contact Map
3us3A	2	0.9911	99.8	0.223	Contact Map
1sjiA	2	0.9911	99.8	0.226	Contact Map
3ed3A	1	1	99.8	0.228	Contact Map
4kcaA	2	0.9643	99.8	0.241	Contact Map
3t58A	1	1	99.7	0.245	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.