MHQP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MHQP - Putative oxidoreductase MhqP

UniProt:	P96694	Sequences: MEDAGLLLIRIMIGVVFLFYGTQKLFGWFGGYGIKGTGQWFESIGVKPGNVAAALSGLGELVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGFEYNLVLIAVSIGVALIGSGAYALHF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (118)
Sequences:	2205 (1550)
Seq/√Len:	142.6

BACSU - MHQP CATD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_F	80_I	2.921	1.00
81_T	111_I	2.606	1.00
12_M	112_A	2.391	1.00
40_W	44_I	2.373	1.00
22_T	26_F	2.270	1.00
80_I	114_S	2.136	1.00
54_A	58_L	2.023	1.00
14_G	64_G	1.986	1.00
104_F	108_L	1.947	1.00
37_T	41_F	1.914	1.00
92_H	107_N	1.912	1.00
16_V	110_L	1.895	1.00
16_V	97_F	1.871	1.00
18_L	68_I	1.864	1.00
67_F	80_I	1.755	1.00
22_T	61_L	1.713	1.00
13_I	113_V	1.697	1.00
56_S	83_I	1.689	1.00
88_I	111_I	1.678	1.00
106_Y	110_L	1.663	1.00
34_I	54_A	1.661	1.00
9_I	116_G	1.653	1.00
40_W	43_S	1.645	1.00
66_L	76_G	1.636	1.00
84_M	87_A	1.595	1.00
16_V	109_V	1.586	1.00
77_A	114_S	1.556	1.00
58_L	62_V	1.527	1.00
71_V	128_H	1.516	1.00
99_N	102_G	1.500	1.00
14_G	68_I	1.499	1.00
6_L	120_I	1.485	1.00
7_L	11_I	1.443	1.00
34_I	57_G	1.431	1.00
117_V	120_I	1.428	1.00
116_G	120_I	1.405	1.00
20_Y	105_E	1.387	1.00
89_V	93_G	1.379	1.00
62_V	66_L	1.333	1.00
73_L	122_S	1.322	1.00
6_L	116_G	1.317	1.00
59_G	83_I	1.314	1.00
109_V	113_V	1.301	1.00
38_G	49_G	1.277	1.00
5_G	120_I	1.264	1.00
65_I	69_L	1.259	1.00
72_F	75_L	1.250	1.00
38_G	50_N	1.232	1.00
12_M	16_V	1.225	1.00
63_S	76_G	1.204	1.00
25_L	57_G	1.199	1.00
18_L	65_I	1.199	1.00
77_A	81_T	1.196	1.00
75_L	79_I	1.193	1.00
122_S	126_A	1.168	1.00
19_F	98_A	1.156	0.99
9_I	113_V	1.136	0.99
18_L	64_G	1.124	0.99
71_V	127_L	1.112	0.99
24_K	60_E	1.110	0.99
57_G	64_G	1.095	0.99
50_N	54_A	1.075	0.99
92_H	95_K	1.058	0.99
46_V	52_A	1.042	0.99
59_G	79_I	1.036	0.99
81_T	118_A	1.018	0.99
88_I	107_N	1.002	0.99
55_L	59_G	0.980	0.98
56_S	59_G	0.972	0.98
82_I	86_G	0.971	0.98
36_G	40_W	0.967	0.98
85_L	89_V	0.951	0.98
88_I	93_G	0.951	0.98
73_L	117_V	0.946	0.98
115_I	119_L	0.925	0.98
34_I	38_G	0.921	0.97
59_G	76_G	0.917	0.97
111_I	114_S	0.911	0.97
34_I	53_A	0.906	0.97
18_L	22_T	0.893	0.97
15_V	68_I	0.891	0.97
88_I	108_L	0.877	0.97
63_S	80_I	0.874	0.97
11_I	68_I	0.859	0.96
74_P	82_I	0.857	0.96
110_L	114_S	0.843	0.96
42_E	49_G	0.830	0.95
59_G	63_S	0.817	0.95
21_G	64_G	0.812	0.95
96_G	104_F	0.810	0.95
39_Q	43_S	0.809	0.95
35_K	39_Q	0.802	0.94
6_L	122_S	0.797	0.94
37_T	53_A	0.783	0.94
46_V	86_G	0.782	0.94
35_K	38_G	0.780	0.94
39_Q	42_E	0.779	0.94
16_V	19_F	0.778	0.93
23_Q	33_G	0.777	0.93
83_I	86_G	0.770	0.93
32_Y	37_T	0.742	0.92
23_Q	32_Y	0.728	0.91
78_A	82_I	0.725	0.91
25_L	61_L	0.720	0.91
13_I	114_S	0.719	0.90
107_N	111_I	0.714	0.90
74_P	118_A	0.705	0.90
5_G	119_L	0.702	0.89
21_G	62_V	0.701	0.89
83_I	87_A	0.699	0.89
33_G	103_G	0.697	0.89
7_L	125_Y	0.696	0.89
109_V	112_A	0.695	0.89
106_Y	109_V	0.693	0.89
38_G	53_A	0.690	0.89
51_V	54_A	0.670	0.87
15_V	65_I	0.665	0.87
122_S	128_H	0.665	0.87
25_L	58_L	0.663	0.87
79_I	82_I	0.662	0.86
95_K	102_G	0.658	0.86
34_I	37_T	0.655	0.86
90_K	94_A	0.654	0.86
96_G	103_G	0.650	0.85
8_L	112_A	0.647	0.85
19_F	64_G	0.639	0.85
76_G	80_I	0.636	0.84
16_V	106_Y	0.631	0.84
113_V	117_V	0.628	0.83
32_Y	35_K	0.621	0.83
41_F	46_V	0.616	0.82
14_G	18_L	0.613	0.82
89_V	104_F	0.610	0.82
61_L	65_I	0.610	0.82
13_I	110_L	0.603	0.81
52_A	86_G	0.603	0.81
80_I	83_I	0.602	0.81
81_T	115_I	0.600	0.81
97_F	106_Y	0.598	0.80
53_A	57_G	0.597	0.80
57_G	61_L	0.589	0.79
100_G	106_Y	0.587	0.79
73_L	128_H	0.584	0.79
76_G	79_I	0.583	0.79
37_T	42_E	0.579	0.78
97_F	108_L	0.578	0.78
69_L	127_L	0.572	0.77
104_F	107_N	0.569	0.77
12_M	109_V	0.568	0.77
13_I	109_V	0.567	0.77
75_L	118_A	0.565	0.77
13_I	82_I	0.563	0.76
32_Y	36_G	0.563	0.76
66_L	71_V	0.562	0.76
8_L	15_V	0.561	0.76
56_S	86_G	0.557	0.76
21_G	61_L	0.555	0.75
42_E	101_A	0.552	0.75
41_F	54_A	0.549	0.75
78_A	118_A	0.543	0.74
63_S	79_I	0.540	0.73
116_G	119_L	0.538	0.73
23_Q	57_G	0.531	0.72
23_Q	98_A	0.530	0.72
32_Y	40_W	0.529	0.72
51_V	71_V	0.526	0.71
108_L	111_I	0.526	0.71
85_L	111_I	0.525	0.71
13_I	92_H	0.523	0.71
54_A	57_G	0.520	0.71
111_I	115_I	0.514	0.70
14_G	21_G	0.512	0.69
91_V	96_G	0.511	0.69
49_G	57_G	0.507	0.69
21_G	72_F	0.505	0.68
17_F	73_L	0.503	0.68
4_A	62_V	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3m4fA	1	0.2326	1.8	0.954	Contact Map
2vgdA	1	0.2791	1.8	0.954	Contact Map
1rijA	1	0.1783	1.4	0.956	Contact Map
2l16A	1	0.2326	1.2	0.958	Contact Map
4ui9A	1	0.6899	1	0.961	Contact Map
2lzrA	1	0.2248	0.9	0.961	Contact Map
2gsmB	1	0.7132	0.8	0.963	Contact Map
3rv1A	2	0.3178	0.7	0.964	Contact Map
1xaxA	1	0.3411	0.7	0.964	Contact Map
2hy5A	2	0.3566	0.7	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.