ASER - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ASER - HTH-type transcriptional repressor AseR

UniProt:	P96677	Sequences: MTIDVAAMTRCLKTLSDQTRLIMMRLFLEQEYCVCQLVDMFEMSQPAISQHLRKLKNAGFVNEDRRGQWRYYSINGSCPEFDTLQLILHQIDQEDELLNHIKQKKTQACCQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	111 (88)
Sequences:	3786 (2554)
Seq/√Len:	272.3

ECOLI - ARSR YGAV
BACSU - ASER ARSR CZRA SDPR YBZH YCEK
HALSA - ARSR2
SULSO - Q97VE0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_E	64_D	4.466	1.00
63_E	70_R	3.045	1.00
62_N	73_S	2.861	1.00
62_N	75_N	2.371	1.00
65_R	70_R	2.307	1.00
53_R	57_N	2.145	1.00
43_M	47_A	2.097	1.00
14_T	58_A	2.088	1.00
82_D	86_L	2.023	1.00
34_V	52_L	1.896	1.00
31_E	73_S	1.742	1.00
10_R	57_N	1.720	1.00
26_L	40_M	1.571	1.00
43_M	48_I	1.570	1.00
38_V	45_Q	1.541	1.00
6_A	18_Q	1.540	1.00
27_F	61_V	1.537	1.00
24_M	60_F	1.521	1.00
26_L	32_Y	1.446	1.00
85_Q	89_H	1.439	1.00
14_T	54_K	1.403	1.00
52_L	61_V	1.381	1.00
37_L	48_I	1.354	1.00
31_E	71_Y	1.348	1.00
56_K	63_E	1.330	1.00
54_K	58_A	1.308	1.00
9_T	18_Q	1.291	1.00
35_C	69_W	1.256	1.00
32_Y	36_Q	1.246	1.00
27_F	32_Y	1.239	1.00
44_S	47_A	1.208	1.00
86_L	89_H	1.199	1.00
12_L	15_L	1.147	1.00
23_M	37_L	1.121	1.00
32_Y	40_M	1.112	1.00
50_Q	68_Q	1.104	1.00
59_G	75_N	1.099	1.00
24_M	74_I	1.086	1.00
34_V	56_K	1.071	1.00
7_A	59_G	1.070	1.00
8_M	87_I	1.065	1.00
17_D	50_Q	1.062	1.00
47_A	50_Q	1.053	1.00
33_C	36_Q	1.049	1.00
28_L	85_Q	1.018	1.00
82_D	85_Q	1.015	1.00
12_L	87_I	1.003	1.00
47_A	51_H	0.982	1.00
13_K	16_S	0.980	1.00
53_R	56_K	0.977	1.00
78_C	93_Q	0.976	1.00
41_F	48_I	0.973	1.00
50_Q	53_R	0.956	1.00
6_A	10_R	0.955	1.00
78_C	90_Q	0.947	1.00
33_C	69_W	0.896	1.00
23_M	27_F	0.894	1.00
62_N	76_G	0.888	1.00
11_C	84_L	0.887	1.00
76_G	90_Q	0.876	1.00
9_T	21_L	0.855	1.00
90_Q	93_Q	0.854	1.00
52_L	56_K	0.844	1.00
12_L	16_S	0.844	1.00
25_R	28_L	0.839	1.00
5_V	25_R	0.825	0.99
15_L	18_Q	0.822	0.99
39_D	69_W	0.813	0.99
36_Q	39_D	0.811	0.99
19_T	48_I	0.809	0.99
11_C	60_F	0.801	0.99
38_V	48_I	0.791	0.99
82_D	89_H	0.791	0.99
55_L	61_V	0.780	0.99
15_L	24_M	0.778	0.99
54_K	57_N	0.774	0.99
8_M	88_L	0.762	0.99
43_M	46_P	0.759	0.99
78_C	83_T	0.749	0.99
24_M	84_L	0.748	0.99
80_E	85_Q	0.745	0.99
14_T	55_L	0.741	0.99
16_S	51_H	0.733	0.99
56_K	70_R	0.709	0.98
19_T	43_M	0.708	0.98
17_D	44_S	0.701	0.98
7_A	82_D	0.696	0.98
80_E	86_L	0.689	0.98
26_L	37_L	0.688	0.98
19_T	65_R	0.677	0.98
31_E	66_R	0.676	0.98
50_Q	54_K	0.664	0.98
77_S	82_D	0.651	0.97
7_A	10_R	0.645	0.97
21_L	25_R	0.638	0.97
44_S	50_Q	0.633	0.97
11_C	58_A	0.624	0.96
36_Q	71_Y	0.620	0.96
77_S	80_E	0.611	0.96
19_T	68_Q	0.601	0.96
46_P	51_H	0.600	0.96
46_P	50_Q	0.600	0.96
86_L	90_Q	0.596	0.95
44_S	68_Q	0.585	0.95
47_A	68_Q	0.579	0.95
5_V	9_T	0.578	0.95
28_L	80_E	0.578	0.95
17_D	47_A	0.577	0.95
32_Y	37_L	0.576	0.94
7_A	18_Q	0.576	0.94
78_C	84_L	0.575	0.94
13_K	47_A	0.574	0.94
11_C	83_T	0.570	0.94
22_I	25_R	0.570	0.94
28_L	74_I	0.569	0.94
76_G	93_Q	0.569	0.94
66_R	71_Y	0.562	0.94
19_T	41_F	0.553	0.93
9_T	16_S	0.550	0.93
5_V	8_M	0.546	0.93
17_D	69_W	0.546	0.93
76_G	80_E	0.543	0.93
34_V	40_M	0.534	0.92
34_V	45_Q	0.532	0.92
38_V	42_E	0.530	0.92
45_Q	69_W	0.524	0.91
75_N	93_Q	0.517	0.91
75_N	78_C	0.517	0.91
50_Q	65_R	0.513	0.90
36_Q	51_H	0.509	0.90
35_C	38_V	0.500	0.89
25_R	29_E	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1r1tA	2	0.8378	99.7	0.509	Contact Map
1u2wA	2	0.8468	99.7	0.527	Contact Map
2jscA	2	0.8649	99.7	0.527	Contact Map
2kkoA	2	0.9099	99.6	0.538	Contact Map
3pqkA	2	0.8739	99.6	0.539	Contact Map
1r1uA	2	0.8559	99.6	0.54	Contact Map
2zkzA	2	0.7928	99.6	0.548	Contact Map
4k2eA	2	0.8288	99.6	0.548	Contact Map
1q1hA	1	0.7207	99.6	0.553	Contact Map
3f6vA	2	0.8649	99.6	0.557	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.