IMMA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

IMMA - Metallopeptidase ImmA

UniProt:	P96630	Sequences: MITIYTSKGIKHKVQSVIKTHGTNNVYEICDIQKIYILKNDLGQANGLLQHDKATDQYLIHINENLQHQQFVIAHELGHYFLHKRLNTFKVVNCSKVLKDKLEHQASLFASELILTDKMLNEALPYIQGFSKEQIAAYFNVPSFVTDYKLSQIGSFSNRIYSHEISAFG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	169 (142)
Sequences:	794 (706)
Seq/√Len:	59.2

BACSU - IMMA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_K	69_Q	4.332	1.00
83_H	105_Q	4.040	1.00
47_G	72_V	3.796	1.00
49_L	80_Y	3.417	1.00
74_A	110_A	3.184	1.00
135_I	146_T	3.050	1.00
30_C	37_I	2.569	1.00
120_L	146_T	2.568	1.00
117_D	121_N	2.236	1.00
11_K	112_E	2.186	1.00
141_V	146_T	2.168	1.00
123_A	139_F	2.145	1.00
108_L	112_E	2.140	1.00
112_E	149_K	2.101	1.00
82_L	105_Q	2.065	1.00
35_I	77_L	2.017	1.00
41_D	64_E	1.928	1.00
72_V	142_P	1.833	1.00
115_L	145_V	1.813	0.99
27_Y	73_I	1.784	0.99
74_A	114_I	1.784	0.99
13_K	16_S	1.778	0.99
46_N	66_L	1.769	0.99
117_D	149_K	1.735	0.99
26_V	30_C	1.728	0.99
132_K	146_T	1.640	0.99
14_V	18_I	1.631	0.99
48_L	61_H	1.631	0.99
78_G	109_F	1.620	0.99
109_F	113_L	1.571	0.99
110_A	114_I	1.544	0.98
74_A	113_L	1.521	0.98
123_A	135_I	1.502	0.98
139_F	146_T	1.501	0.98
120_L	150_L	1.494	0.98
10_I	14_V	1.477	0.98
30_C	60_I	1.465	0.98
62_I	73_I	1.463	0.98
39_K	62_I	1.419	0.97
123_A	138_Y	1.388	0.97
104_H	107_S	1.309	0.95
35_I	80_Y	1.286	0.95
49_L	58_Y	1.284	0.95
71_F	116_T	1.280	0.95
26_V	73_I	1.279	0.95
135_I	139_F	1.273	0.95
71_F	142_P	1.267	0.95
116_T	119_M	1.263	0.94
72_V	149_K	1.260	0.94
147_D	151_S	1.254	0.94
62_I	69_Q	1.238	0.94
41_D	65_N	1.221	0.93
78_G	82_L	1.216	0.93
27_Y	39_K	1.200	0.93
45_A	48_L	1.199	0.93
71_F	145_V	1.185	0.92
46_N	69_Q	1.171	0.92
104_H	108_L	1.161	0.92
58_Y	80_Y	1.127	0.90
77_L	81_F	1.113	0.90
36_Y	59_L	1.106	0.89
148_Y	152_Q	1.099	0.89
28_E	32_I	1.096	0.89
66_L	72_V	1.086	0.89
10_I	108_L	1.056	0.87
14_V	109_F	1.053	0.87
30_C	73_I	1.050	0.87
116_T	142_P	1.049	0.87
18_I	24_N	1.035	0.86
115_L	141_V	1.003	0.84
26_V	77_L	0.990	0.83
136_A	141_V	0.984	0.83
133_E	143_S	0.980	0.83
18_I	23_T	0.965	0.82
111_S	115_L	0.929	0.79
38_L	61_H	0.923	0.79
101_K	105_Q	0.916	0.78
107_S	112_E	0.916	0.78
46_N	145_V	0.904	0.77
21_H	29_I	0.896	0.77
53_K	56_D	0.895	0.77
146_T	150_L	0.895	0.77
51_H	56_D	0.892	0.76
72_V	116_T	0.883	0.76
35_I	60_I	0.870	0.75
50_Q	59_L	0.869	0.75
47_G	120_L	0.869	0.75
66_L	144_F	0.853	0.73
130_F	134_Q	0.847	0.73
33_Q	77_L	0.846	0.73
47_G	63_N	0.840	0.72
145_V	149_K	0.831	0.71
39_K	48_L	0.816	0.70
41_D	125_P	0.810	0.69
18_I	21_H	0.808	0.69
115_L	120_L	0.806	0.69
78_G	136_A	0.804	0.69
10_I	109_F	0.802	0.69
35_I	98_L	0.799	0.68
70_Q	74_A	0.795	0.68
143_S	147_D	0.794	0.68
40_N	48_L	0.794	0.68
37_I	44_Q	0.790	0.67
71_F	110_A	0.789	0.67
58_Y	84_K	0.788	0.67
21_H	33_Q	0.787	0.67
46_N	142_P	0.786	0.67
46_N	78_G	0.784	0.67
77_L	131_S	0.777	0.66
15_Q	18_I	0.775	0.66
46_N	149_K	0.766	0.65
36_Y	52_D	0.762	0.65
61_H	120_L	0.758	0.64
86_L	102_L	0.746	0.63
41_D	68_H	0.721	0.60
18_I	99_K	0.714	0.60
11_K	117_D	0.710	0.59
26_V	29_I	0.695	0.57
75_H	79_H	0.693	0.57
15_Q	19_K	0.690	0.57
73_I	82_L	0.686	0.56
115_L	149_K	0.685	0.56
142_P	149_K	0.683	0.56
18_I	116_T	0.683	0.56
149_K	153_I	0.667	0.54
63_N	66_L	0.665	0.54
17_V	20_T	0.662	0.54
50_Q	61_H	0.662	0.54
42_L	61_H	0.660	0.54
144_F	148_Y	0.659	0.53
131_S	134_Q	0.656	0.53
136_A	146_T	0.653	0.53
107_S	111_S	0.652	0.53
60_I	73_I	0.646	0.52
98_L	141_V	0.641	0.51
30_C	98_L	0.637	0.51
25_N	70_Q	0.634	0.51
111_S	116_T	0.630	0.50
108_L	149_K	0.626	0.50
34_K	113_L	0.612	0.48
72_V	145_V	0.612	0.48
13_K	19_K	0.611	0.48
90_K	93_N	0.609	0.48
75_H	103_E	0.605	0.47
132_K	143_S	0.604	0.47
116_T	135_I	0.603	0.47
37_I	123_A	0.600	0.47
129_G	135_I	0.597	0.47
83_H	110_A	0.596	0.46
70_Q	115_L	0.596	0.46
26_V	94_C	0.594	0.46
136_A	143_S	0.593	0.46
76_E	79_H	0.592	0.46
42_L	85_R	0.592	0.46
115_L	132_K	0.590	0.46
27_Y	70_Q	0.588	0.46
85_R	125_P	0.585	0.45
23_T	122_E	0.584	0.45
25_N	28_E	0.583	0.45
61_H	89_F	0.582	0.45
42_L	73_I	0.580	0.45
79_H	103_E	0.578	0.44
142_P	150_L	0.573	0.44
62_I	127_I	0.570	0.44
119_M	139_F	0.567	0.43
11_K	18_I	0.563	0.43
46_N	72_V	0.563	0.43
33_Q	111_S	0.559	0.42
142_P	145_V	0.559	0.42
20_T	28_E	0.558	0.42
10_I	13_K	0.557	0.42
51_H	85_R	0.555	0.42
59_L	125_P	0.555	0.42
21_H	47_G	0.554	0.42
17_V	81_F	0.554	0.42
93_N	97_V	0.551	0.42
111_S	142_P	0.551	0.42
27_Y	30_C	0.551	0.42
101_K	104_H	0.551	0.42
74_A	141_V	0.549	0.41
56_D	140_N	0.548	0.41
113_L	139_F	0.547	0.41
50_Q	57_Q	0.547	0.41
56_D	117_D	0.546	0.41
46_N	71_F	0.542	0.41
67_Q	132_K	0.538	0.40
12_H	16_S	0.537	0.40
29_I	66_L	0.536	0.40
136_A	139_F	0.536	0.40
22_G	132_K	0.531	0.39
18_I	113_L	0.530	0.39
47_G	66_L	0.527	0.39
61_H	64_E	0.525	0.39
82_L	147_D	0.523	0.39
63_N	69_Q	0.522	0.38
11_K	149_K	0.521	0.38
107_S	151_S	0.520	0.38
18_I	147_D	0.519	0.38
35_I	96_K	0.517	0.38
31_D	101_K	0.514	0.38
50_Q	53_K	0.508	0.37
29_I	63_N	0.507	0.37
98_L	105_Q	0.507	0.37
39_K	92_V	0.506	0.37
60_I	82_L	0.505	0.37
57_Q	85_R	0.505	0.37
43_G	67_Q	0.505	0.37
13_K	108_L	0.503	0.36
78_G	83_H	0.502	0.36
49_L	136_A	0.502	0.36
76_E	103_E	0.502	0.36
130_F	135_I	0.501	0.36
70_Q	116_T	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dteA	2	0.9527	100	0.432	Contact Map
4il3A	1	0.858	97.6	0.827	Contact Map
4aw6A	2	0.8639	97.4	0.834	Contact Map
3c37A	1	0.8876	96.1	0.86	Contact Map
3cqbA	4	0.4911	94.6	0.873	Contact Map
4dv8A	1	0.8166	91	0.887	Contact Map
4qhjA	2	0.5917	89	0.892	Contact Map
5a0rA	1	0.8047	86.1	0.897	Contact Map
1j7nA	2	0.8521	84.7	0.899	Contact Map
4jixA	2	0.5976	81.1	0.903	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.022 seconds.