SPRTL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPRTL - Protein SprT-like

UniProt:	P96628	Sequences: MDNKELQKLTEDISETYFKKPFRHQALFNDRLKTTGGRYLLTSHNIELNRKYLIEHGREELIGIIKHELCHYHLHLEGKGYKHRDRDFRMLLQQVNAPRFCTPLKKKAENKKTYMYICTTCGQQYIKKRAMNPDRYRCGKCRGKIKRIFS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (145)
Sequences:	464 (362)
Seq/√Len:	30.0

BACSU - SPRTL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_K	77_E	7.002	1.00
7_Q	11_E	3.944	1.00
48_L	61_L	2.957	1.00
40_L	47_E	2.915	1.00
80_G	85_D	2.876	1.00
52_Y	101_C	2.838	1.00
12_D	16_T	2.753	1.00
10_T	26_A	2.615	1.00
14_S	73_H	2.508	0.99
44_H	76_L	2.458	0.99
9_L	62_I	2.434	0.99
39_Y	75_H	2.403	0.99
27_L	45_N	2.391	0.99
41_L	44_H	2.211	0.98
62_I	66_K	2.140	0.98
13_I	65_I	2.055	0.98
79_K	87_D	2.042	0.97
84_R	89_R	1.996	0.97
131_M	145_I	1.977	0.97
40_L	43_S	1.920	0.96
86_R	90_M	1.839	0.95
2_D	95_V	1.745	0.94
30_D	50_R	1.701	0.93
24_H	44_H	1.698	0.93
117_I	122_G	1.675	0.92
2_D	5_E	1.650	0.92
10_T	46_I	1.597	0.90
81_Y	85_D	1.472	0.86
58_R	62_I	1.471	0.86
82_K	85_D	1.449	0.85
13_I	66_K	1.410	0.84
80_G	87_D	1.396	0.83
92_L	97_A	1.388	0.83
25_Q	45_N	1.366	0.82
119_T	146_K	1.352	0.81
60_E	98_P	1.332	0.80
7_Q	44_H	1.324	0.79
39_Y	44_H	1.321	0.79
40_L	45_N	1.290	0.78
39_Y	76_L	1.276	0.77
117_I	124_Q	1.267	0.76
44_H	75_H	1.229	0.74
1_M	28_F	1.188	0.71
92_L	136_Y	1.170	0.70
60_E	104_L	1.160	0.70
78_G	87_D	1.140	0.68
10_T	65_I	1.118	0.67
3_N	27_L	1.114	0.66
52_Y	105_K	1.105	0.66
60_E	101_C	1.103	0.66
98_P	101_C	1.097	0.65
66_K	96_N	1.088	0.65
6_L	50_R	1.083	0.64
34_T	49_N	1.073	0.63
125_Y	145_I	1.069	0.63
115_M	124_Q	1.061	0.63
53_L	61_L	1.047	0.62
55_E	106_K	1.040	0.61
46_I	61_L	1.036	0.61
9_L	65_I	1.021	0.60
55_E	104_L	1.015	0.59
28_F	32_L	0.996	0.58
98_P	102_T	0.983	0.57
56_H	104_L	0.983	0.57
11_E	44_H	0.976	0.56
46_I	101_C	0.976	0.56
97_A	102_T	0.975	0.56
10_T	15_E	0.975	0.56
52_Y	60_E	0.972	0.56
64_I	101_C	0.966	0.55
94_Q	113_T	0.963	0.55
9_L	116_Y	0.948	0.54
25_Q	129_R	0.942	0.53
7_Q	39_Y	0.939	0.53
5_E	28_F	0.937	0.53
53_L	56_H	0.936	0.53
81_Y	87_D	0.934	0.53
123_Q	140_K	0.932	0.53
125_Y	142_R	0.931	0.53
52_Y	64_I	0.923	0.52
40_L	101_C	0.920	0.52
125_Y	139_G	0.919	0.52
30_D	54_I	0.918	0.51
139_G	145_I	0.918	0.51
53_L	57_G	0.917	0.51
52_Y	98_P	0.897	0.50
61_L	64_I	0.896	0.50
47_E	101_C	0.884	0.49
60_E	102_T	0.880	0.48
20_K	78_G	0.870	0.48
20_K	23_R	0.868	0.48
113_T	128_K	0.861	0.47
24_H	41_L	0.832	0.45
24_H	73_H	0.826	0.44
41_L	75_H	0.825	0.44
47_E	64_I	0.822	0.44
3_N	25_Q	0.822	0.44
56_H	105_K	0.810	0.43
115_M	126_I	0.808	0.43
3_N	134_D	0.808	0.43
30_D	51_K	0.803	0.42
41_L	76_L	0.785	0.41
33_K	131_M	0.783	0.41
60_E	64_I	0.780	0.41
119_T	123_Q	0.775	0.40
87_D	90_M	0.774	0.40
7_Q	75_H	0.773	0.40
12_D	137_R	0.766	0.40
97_A	101_C	0.765	0.39
93_Q	117_I	0.762	0.39
62_I	65_I	0.750	0.38
4_K	8_K	0.750	0.38
34_T	78_G	0.747	0.38
56_H	130_A	0.744	0.38
57_G	100_F	0.743	0.38
10_T	48_L	0.742	0.38
19_K	117_I	0.739	0.38
52_Y	102_T	0.737	0.37
52_Y	57_G	0.736	0.37
4_K	132_N	0.736	0.37
11_E	76_L	0.732	0.37
121_C	143_G	0.732	0.37
16_T	146_K	0.730	0.37
23_R	120_T	0.725	0.36
57_G	70_C	0.725	0.36
125_Y	140_K	0.724	0.36
9_L	41_L	0.721	0.36
70_C	121_C	0.716	0.36
32_L	50_R	0.713	0.36
13_I	63_G	0.710	0.35
26_A	73_H	0.709	0.35
40_L	98_P	0.709	0.35
49_N	116_Y	0.708	0.35
50_R	97_A	0.705	0.35
61_L	78_G	0.704	0.35
13_I	17_Y	0.702	0.35
2_D	8_K	0.695	0.34
41_L	61_L	0.695	0.34
52_Y	104_L	0.685	0.34
116_Y	133_P	0.685	0.34
113_T	136_Y	0.676	0.33
17_Y	66_K	0.675	0.33
1_M	5_E	0.673	0.33
117_I	146_K	0.672	0.33
91_L	95_V	0.671	0.33
137_R	144_K	0.669	0.32
93_Q	115_M	0.666	0.32
15_E	109_E	0.660	0.32
74_L	89_R	0.656	0.32
24_H	43_S	0.655	0.31
122_G	126_I	0.654	0.31
7_Q	24_H	0.645	0.31
91_L	94_Q	0.645	0.31
34_T	41_L	0.637	0.30
7_Q	76_L	0.635	0.30
23_R	86_R	0.635	0.30
55_E	95_V	0.634	0.30
30_D	142_R	0.634	0.30
26_A	56_H	0.630	0.30
52_Y	56_H	0.625	0.29
32_L	57_G	0.624	0.29
58_R	93_Q	0.624	0.29
111_K	128_K	0.623	0.29
11_E	137_R	0.622	0.29
63_G	92_L	0.618	0.29
111_K	131_M	0.618	0.29
94_Q	109_E	0.610	0.28
110_N	146_K	0.608	0.28
119_T	144_K	0.602	0.28
63_G	66_K	0.597	0.28
33_K	40_L	0.592	0.27
3_N	26_A	0.590	0.27
115_M	133_P	0.588	0.27
89_R	100_F	0.587	0.27
41_L	49_N	0.586	0.27
27_L	47_E	0.585	0.27
8_K	12_D	0.584	0.27
8_K	87_D	0.583	0.27
8_K	21_P	0.582	0.27
76_L	82_K	0.582	0.27
7_Q	41_L	0.581	0.27
56_H	103_P	0.581	0.27
46_I	85_D	0.580	0.27
28_F	39_Y	0.579	0.27
12_D	15_E	0.576	0.26
7_Q	10_T	0.575	0.26
24_H	95_V	0.572	0.26
15_E	144_K	0.572	0.26
34_T	122_G	0.571	0.26
112_K	130_A	0.570	0.26
9_L	61_L	0.563	0.26
115_M	140_K	0.562	0.25
43_S	102_T	0.558	0.25
48_L	97_A	0.558	0.25
63_G	97_A	0.557	0.25
43_S	101_C	0.556	0.25
82_K	100_F	0.547	0.25
19_K	120_T	0.546	0.25
3_N	15_E	0.544	0.24
11_E	39_Y	0.540	0.24
6_L	48_L	0.536	0.24
92_L	108_A	0.531	0.24
19_K	94_Q	0.531	0.24
24_H	45_N	0.529	0.24
46_I	125_Y	0.529	0.24
115_M	122_G	0.528	0.23
27_L	40_L	0.527	0.23
43_S	57_G	0.526	0.23
3_N	46_I	0.526	0.23
94_Q	124_Q	0.524	0.23
114_Y	131_M	0.515	0.23
12_D	144_K	0.511	0.23
25_Q	93_Q	0.511	0.23
90_M	94_Q	0.508	0.22
19_K	86_R	0.507	0.22
114_Y	133_P	0.506	0.22
90_M	134_D	0.502	0.22
74_L	83_H	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jixA	2	0.7067	99.3	0.815	Contact Map
4qhjA	2	0.7	96.3	0.912	Contact Map
4jiuA	1	0.6933	95.1	0.919	Contact Map
3cqbA	4	0.5467	91.3	0.93	Contact Map
4aybP	1	0.22	89.2	0.933	Contact Map
2lcqA	1	0.7467	87.9	0.935	Contact Map
4il3A	1	0.8667	86.6	0.936	Contact Map
4qiwP	1	0.2133	83	0.939	Contact Map
1vd4A	1	0.32	72.8	0.944	Contact Map
2dulA	2	0.88	56.3	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.