ACPS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ACPS - Holo-[acyl-carrier-protein] synthase

UniProt:	P96618	Sequences: MIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAAQVVIERLSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	121 (113)
Sequences:	2752 (1997)
Seq/√Len:	187.9

ECOLI - ACPS
BACSU - ACPS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_G	103_I	2.456	1.00
7_L	111_A	2.359	1.00
5_I	113_Q	2.323	1.00
82_D	86_K	2.237	1.00
100_H	117_E	2.198	1.00
52_G	105_H	2.166	1.00
33_S	78_E	2.162	1.00
31_T	78_E	2.108	1.00
7_L	113_Q	2.101	1.00
56_A	101_V	2.071	1.00
60_F	89_I	2.060	1.00
89_I	114_V	2.037	1.00
56_A	79_I	2.003	1.00
104_T	111_A	1.959	1.00
53_R	81_K	1.916	1.00
11_E	108_E	1.881	1.00
27_E	35_L	1.838	1.00
60_F	114_V	1.788	1.00
26_A	35_L	1.786	1.00
99_V	116_I	1.715	1.00
9_I	109_Y	1.665	1.00
16_A	20_G	1.618	1.00
80_R	88_Y	1.611	1.00
55_A	112_A	1.589	1.00
11_E	106_T	1.517	1.00
61_S	68_I	1.509	1.00
37_Q	81_K	1.460	1.00
38_Y	50_L	1.427	1.00
23_K	27_E	1.415	1.00
60_F	77_I	1.391	1.00
7_L	102_S	1.378	1.00
13_K	108_E	1.336	1.00
48_E	105_H	1.330	1.00
12_L	47_N	1.311	1.00
77_I	89_I	1.304	1.00
80_R	90_I	1.265	1.00
91_C	99_V	1.255	1.00
4_G	100_H	1.245	1.00
78_E	92_T	1.211	1.00
9_I	111_A	1.205	1.00
45_R	48_E	1.190	1.00
39_Y	50_L	1.173	1.00
12_L	110_A	1.170	1.00
35_L	39_Y	1.170	1.00
98_A	117_E	1.165	1.00
10_T	15_I	1.162	1.00
30_L	49_F	1.161	1.00
38_Y	49_F	1.158	1.00
68_I	74_F	1.157	1.00
33_S	36_D	1.140	1.00
9_I	104_T	1.121	1.00
10_T	55_A	1.120	1.00
10_T	110_A	1.118	1.00
60_F	64_F	1.115	1.00
30_L	50_L	1.105	1.00
61_S	67_G	1.104	1.00
82_D	88_Y	1.103	1.00
78_E	90_I	1.101	1.00
18_M	25_F	1.086	1.00
13_K	16_A	1.086	1.00
25_F	29_I	1.081	1.00
61_S	72_L	1.080	1.00
43_E	46_K	1.045	1.00
2_I	100_H	1.037	1.00
11_E	107_K	1.002	0.99
19_A	50_L	0.988	0.99
56_A	103_I	0.982	0.99
7_L	104_T	0.982	0.99
16_A	47_N	0.977	0.99
96_Q	116_I	0.973	0.99
27_E	32_R	0.967	0.99
19_A	26_A	0.966	0.99
19_A	47_N	0.966	0.99
30_L	38_Y	0.966	0.99
63_A	116_I	0.944	0.99
15_I	25_F	0.917	0.99
89_I	99_V	0.916	0.99
73_S	76_D	0.914	0.99
49_F	53_R	0.913	0.99
16_A	45_R	0.911	0.99
106_T	109_Y	0.900	0.99
2_I	117_E	0.898	0.99
33_S	80_R	0.885	0.99
61_S	66_T	0.879	0.99
65_G	86_K	0.878	0.99
60_F	99_V	0.868	0.99
79_I	101_V	0.847	0.98
32_R	36_D	0.838	0.98
35_L	50_L	0.819	0.98
26_A	39_Y	0.815	0.98
72_L	77_I	0.814	0.98
13_K	107_K	0.810	0.98
32_R	75_Q	0.801	0.97
12_L	51_A	0.799	0.97
2_I	115_V	0.784	0.97
10_T	106_T	0.782	0.97
37_Q	49_F	0.753	0.96
94_L	97_A	0.750	0.96
61_S	77_I	0.744	0.96
61_S	74_F	0.742	0.96
39_Y	46_K	0.740	0.96
60_F	91_C	0.732	0.96
48_E	52_G	0.721	0.95
18_M	22_Q	0.710	0.95
26_A	30_L	0.704	0.95
93_K	97_A	0.693	0.94
19_A	22_Q	0.689	0.94
55_A	110_A	0.687	0.94
14_R	28_R	0.678	0.94
86_K	100_H	0.674	0.93
76_D	92_T	0.674	0.93
19_A	38_Y	0.670	0.93
30_L	37_Q	0.664	0.93
12_L	106_T	0.657	0.93
29_I	54_F	0.655	0.92
96_Q	99_V	0.650	0.92
23_K	35_L	0.648	0.92
106_T	113_Q	0.643	0.92
55_A	59_A	0.636	0.91
46_K	50_L	0.634	0.91
109_Y	113_Q	0.633	0.91
79_I	89_I	0.633	0.91
93_K	96_Q	0.630	0.91
38_Y	53_R	0.625	0.91
10_T	18_M	0.624	0.91
106_T	111_A	0.620	0.90
18_M	21_R	0.615	0.90
31_T	75_Q	0.614	0.90
59_A	114_V	0.612	0.90
3_Y	97_A	0.611	0.90
100_H	113_Q	0.610	0.90
49_F	52_G	0.607	0.89
80_R	101_V	0.607	0.89
36_D	40_E	0.607	0.89
9_I	106_T	0.606	0.89
15_I	18_M	0.601	0.89
100_H	115_V	0.598	0.89
11_E	109_Y	0.593	0.88
26_A	50_L	0.592	0.88
3_Y	96_Q	0.591	0.88
24_R	27_E	0.589	0.88
33_S	90_I	0.587	0.88
5_I	14_R	0.579	0.87
54_F	74_F	0.576	0.87
31_T	92_T	0.576	0.87
36_D	39_Y	0.574	0.86
64_F	72_L	0.573	0.86
59_A	112_A	0.572	0.86
5_I	102_S	0.567	0.86
89_I	101_V	0.566	0.86
5_I	100_H	0.560	0.85
4_G	63_A	0.554	0.85
10_T	14_R	0.550	0.84
60_F	116_I	0.549	0.84
37_Q	40_E	0.548	0.84
29_I	74_F	0.547	0.84
14_R	54_F	0.540	0.83
8_D	58_E	0.537	0.83
20_G	32_R	0.536	0.83
65_G	68_I	0.536	0.83
57_K	77_I	0.532	0.82
50_L	53_R	0.531	0.82
4_G	117_E	0.522	0.81
5_I	115_V	0.522	0.81
53_R	101_V	0.517	0.80
31_T	79_I	0.514	0.80
92_T	97_A	0.508	0.79
2_I	5_I	0.505	0.79
3_Y	60_F	0.502	0.78
20_G	23_K	0.500	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2uv9A	5	0	100	0.151	Contact Map
2uv8A	6	0	100	0.152	Contact Map
2qg8A	3	0.8678	100	0.191	Contact Map
2bddA	3	0.8182	100	0.192	Contact Map
3nfdA	3	0.9669	100	0.239	Contact Map
2wdsA	3	0.9421	100	0.258	Contact Map
3hykA	3	0.9504	100	0.262	Contact Map
3qmnA	4	0.9669	100	0.268	Contact Map
3gwmA	3	0.9669	100	0.272	Contact Map
1fthA	3	0.9587	100	0.282	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.