YDAS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YDAS - UPF0410 protein YdaS

UniProt:	P96594	Sequences: MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	85 (79)
Sequences:	417 (205)
Seq/√Len:	23.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
72_F	76_L	3.238	1.00
38_L	58_F	3.176	1.00
12_I	30_I	3.117	1.00
48_L	65_I	3.000	1.00
3_S	7_S	2.681	0.99
27_P	32_G	2.456	0.98
54_S	59_A	2.321	0.97
43_I	70_F	2.179	0.96
7_S	38_L	2.088	0.95
17_I	20_A	2.059	0.95
12_I	34_M	1.936	0.92
53_P	60_I	1.877	0.91
41_A	63_A	1.870	0.91
28_G	32_G	1.713	0.87
53_P	61_F	1.643	0.84
70_F	74_L	1.590	0.82
73_L	77_I	1.529	0.80
64_I	68_A	1.499	0.78
47_L	69_I	1.428	0.75
14_I	71_V	1.422	0.75
41_A	71_V	1.415	0.74
6_V	58_F	1.395	0.73
25_R	32_G	1.384	0.73
11_A	33_S	1.343	0.70
14_I	63_A	1.290	0.67
72_F	77_I	1.288	0.67
8_L	33_S	1.248	0.64
12_I	33_S	1.215	0.62
17_I	25_R	1.175	0.60
16_L	20_A	1.153	0.58
25_R	28_G	1.104	0.55
32_G	42_W	1.073	0.53
51_W	61_F	1.071	0.53
3_S	45_H	1.069	0.52
12_I	16_L	1.065	0.52
57_G	61_F	1.043	0.51
4_F	7_S	1.034	0.50
45_H	48_L	1.017	0.49
23_G	68_A	0.976	0.46
18_G	75_G	0.939	0.43
7_S	58_F	0.939	0.43
25_R	77_I	0.908	0.41
76_L	79_R	0.906	0.41
36_A	74_L	0.896	0.40
56_A	59_A	0.890	0.40
26_L	32_G	0.887	0.40
50_T	67_A	0.886	0.40
35_I	61_F	0.871	0.39
44_G	49_G	0.870	0.39
11_A	19_S	0.865	0.38
19_S	22_V	0.860	0.38
42_W	46_G	0.849	0.37
4_F	42_W	0.836	0.36
38_L	64_I	0.828	0.36
23_G	26_L	0.826	0.36
13_V	17_I	0.822	0.36
58_F	63_A	0.813	0.35
38_L	45_H	0.789	0.34
27_P	42_W	0.769	0.32
7_S	56_A	0.758	0.32
16_L	78_F	0.741	0.31
34_M	77_I	0.741	0.31
19_S	75_G	0.732	0.30
68_A	72_F	0.723	0.30
4_F	65_I	0.699	0.28
8_L	75_G	0.697	0.28
43_I	46_G	0.695	0.28
6_V	10_V	0.687	0.28
2_L	16_L	0.685	0.27
13_V	78_F	0.684	0.27
13_V	54_S	0.679	0.27
33_S	68_A	0.660	0.26
48_L	51_W	0.650	0.25
3_S	54_S	0.648	0.25
59_A	69_I	0.643	0.25
14_I	56_A	0.640	0.25
24_N	27_P	0.639	0.25
21_I	68_A	0.635	0.25
6_V	24_N	0.624	0.24
21_I	75_G	0.622	0.24
2_L	67_A	0.620	0.24
39_I	48_L	0.617	0.24
20_A	31_F	0.616	0.24
59_A	62_P	0.614	0.24
72_F	80_G	0.608	0.23
31_F	50_T	0.607	0.23
76_L	80_G	0.607	0.23
54_S	60_I	0.603	0.23
11_A	68_A	0.602	0.23
44_G	62_P	0.599	0.23
46_G	50_T	0.596	0.23
13_V	16_L	0.589	0.22
34_M	75_G	0.587	0.22
47_L	59_A	0.586	0.22
2_L	14_I	0.579	0.22
48_L	69_I	0.574	0.22
4_F	54_S	0.569	0.21
10_V	57_G	0.560	0.21
48_L	54_S	0.559	0.21
6_V	11_A	0.556	0.21
30_I	34_M	0.555	0.21
65_I	71_V	0.547	0.20
56_A	64_I	0.544	0.20
39_I	47_L	0.543	0.20
12_I	24_N	0.543	0.20
14_I	48_L	0.539	0.20
25_R	33_S	0.531	0.20
13_V	46_G	0.524	0.19
7_S	45_H	0.521	0.19
16_L	30_I	0.521	0.19
47_L	57_G	0.521	0.19
17_I	60_I	0.515	0.19
20_A	25_R	0.515	0.19
48_L	61_F	0.509	0.19
74_L	78_F	0.507	0.19
35_I	64_I	0.502	0.18
35_I	73_L	0.500	0.18
18_G	69_I	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4z7fA	2	0.9882	30.8	0.907	Contact Map
4tkrA	2	0.9294	21.8	0.914	Contact Map
4rp9A	2	0.9765	20.2	0.915	Contact Map
2j69A	1	0.7765	19.6	0.915	Contact Map
4rfsS	1	0.9294	18.3	0.917	Contact Map
3dh4A	3	0.9529	14.5	0.92	Contact Map
3rlbA	1	0.9294	12.2	0.923	Contact Map
2xq2A	2	0.9529	11.7	0.924	Contact Map
4huqS	1	0.9765	11.3	0.924	Contact Map
3qnqA	2	0.9059	10.9	0.925	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.