MUTT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MUTT - Putative 8-oxo-dGTP diphosphatase

UniProt:	P96590	Sequences: MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAAVREILEETGYNAALSAKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGRLPLFMVPNRKRQINDFKNGAQDVNVTVKDSGLLAAIDLLKRRLGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (120)
Sequences:	8981 (6476)
Seq/√Len:	591.2

ECOLI - NUDJ NUDG MUTT NUDC RPPH
BACSU - MUTT YJHB YVCI
HALSA - Q9HR46 Q9HS29
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_L	56_N	4.174	1.00
12_N	16_Q	3.784	1.00
21_K	96_G	3.268	1.00
35_V	44_A	3.089	1.00
8_V	45_A	2.807	1.00
16_Q	101_S	2.724	1.00
21_K	95_A	2.623	1.00
40_S	43_E	2.591	1.00
8_V	49_I	2.127	1.00
60_S	81_S	2.059	1.00
19_L	100_V	1.967	1.00
20_V	94_T	1.956	1.00
101_S	104_R	1.944	1.00
8_V	80_G	1.937	1.00
49_I	57_A	1.894	1.00
46_V	50_L	1.788	1.00
23_K	95_A	1.726	1.00
57_A	80_G	1.673	1.00
58_A	81_S	1.619	1.00
55_Y	82_I	1.598	1.00
10_V	49_I	1.583	1.00
114_K	118_N	1.569	1.00
100_V	108_F	1.520	1.00
62_K	65_V	1.504	1.00
11_L	79_F	1.481	1.00
58_A	83_T	1.435	1.00
66_Y	119_D	1.402	1.00
106_P	118_N	1.376	1.00
102_P	121_K	1.316	1.00
20_V	97_L	1.294	1.00
98_K	108_F	1.281	1.00
62_K	76_H	1.271	1.00
56_N	84_G	1.249	1.00
118_N	122_N	1.226	1.00
35_V	41_A	1.216	1.00
65_V	76_H	1.213	1.00
41_A	76_H	1.211	1.00
46_V	59_L	1.188	1.00
64_G	119_D	1.177	1.00
61_A	79_F	1.172	1.00
39_E	47_R	1.171	1.00
46_V	58_A	1.168	1.00
34_R	73_D	1.166	1.00
18_L	99_W	1.165	1.00
31_P	53_T	1.162	1.00
115_R	118_N	1.153	1.00
41_A	78_F	1.114	1.00
6_A	45_A	1.105	1.00
90_D	93_E	1.103	1.00
7_F	77_L	1.075	1.00
22_R	94_T	1.074	1.00
67_Q	72_Q	1.064	1.00
43_E	46_V	1.064	1.00
82_I	85_G	1.041	1.00
4_Q	35_V	1.036	1.00
55_Y	87_A	1.030	1.00
59_L	80_G	1.024	1.00
28_W	98_K	1.018	1.00
115_R	119_D	0.990	1.00
22_R	29_D	0.986	1.00
5_G	34_R	0.986	1.00
11_L	120_F	0.973	1.00
89_A	92_T	0.964	1.00
91_G	94_T	0.957	1.00
49_I	80_G	0.942	1.00
60_S	79_F	0.933	1.00
15_Q	101_S	0.933	1.00
100_V	104_R	0.928	1.00
6_A	44_A	0.923	1.00
56_N	83_T	0.914	1.00
27_L	109_M	0.913	1.00
5_G	73_D	0.911	1.00
46_V	56_N	0.891	1.00
119_D	122_N	0.881	1.00
61_A	123_G	0.877	1.00
18_L	97_L	0.876	1.00
28_W	100_V	0.873	1.00
4_Q	76_H	0.873	1.00
19_L	108_F	0.871	1.00
105_L	117_I	0.871	1.00
15_Q	102_P	0.868	1.00
100_V	106_P	0.858	1.00
77_L	116_Q	0.854	1.00
26_P	95_A	0.852	1.00
9_I	120_F	0.852	1.00
21_K	28_W	0.849	1.00
63_I	79_F	0.848	1.00
50_L	54_G	0.847	1.00
88_M	92_T	0.847	1.00
119_D	123_G	0.846	1.00
46_V	57_A	0.845	1.00
21_K	26_P	0.844	1.00
11_L	15_Q	0.841	1.00
111_P	114_K	0.832	1.00
79_F	120_F	0.831	1.00
7_F	30_L	0.790	1.00
39_E	44_A	0.776	1.00
104_R	107_L	0.775	1.00
80_G	83_T	0.759	1.00
18_L	55_Y	0.758	1.00
9_I	30_L	0.755	1.00
29_D	113_R	0.727	1.00
68_R	73_D	0.724	1.00
35_V	74_E	0.724	1.00
29_D	73_D	0.718	1.00
110_V	113_R	0.716	1.00
10_V	53_T	0.715	1.00
59_L	62_K	0.709	1.00
73_D	77_L	0.706	1.00
29_D	32_G	0.703	1.00
20_V	31_P	0.700	1.00
32_G	73_D	0.696	1.00
7_F	75_Q	0.695	1.00
87_A	97_L	0.692	1.00
88_M	91_G	0.690	1.00
54_G	88_M	0.690	1.00
9_I	17_I	0.690	1.00
84_G	87_A	0.690	1.00
27_L	108_F	0.689	1.00
42_E	46_V	0.687	1.00
29_D	112_N	0.685	1.00
118_N	121_K	0.683	1.00
28_W	96_G	0.681	1.00
98_K	104_R	0.679	1.00
19_L	110_V	0.679	1.00
37_P	72_Q	0.676	1.00
106_P	121_K	0.676	1.00
120_F	123_G	0.671	1.00
32_G	77_L	0.663	1.00
113_R	116_Q	0.663	1.00
45_A	80_G	0.661	1.00
113_R	117_I	0.651	1.00
7_F	112_N	0.646	1.00
11_L	102_P	0.640	1.00
50_L	53_T	0.638	1.00
105_L	108_F	0.633	1.00
45_A	78_F	0.633	1.00
16_Q	104_R	0.632	1.00
45_A	49_I	0.628	1.00
42_E	78_F	0.624	1.00
46_V	60_S	0.624	1.00
29_D	34_R	0.612	1.00
111_P	115_R	0.612	1.00
59_L	82_I	0.611	1.00
46_V	49_I	0.609	1.00
13_E	81_S	0.603	1.00
103_G	106_P	0.603	1.00
61_A	64_G	0.601	1.00
66_Y	77_L	0.594	1.00
4_Q	74_E	0.585	1.00
7_F	32_G	0.582	1.00
41_A	67_Q	0.576	1.00
30_L	77_L	0.575	1.00
112_N	116_Q	0.574	1.00
19_L	98_K	0.570	1.00
20_V	29_D	0.565	1.00
23_K	94_T	0.564	1.00
83_T	86_Q	0.558	0.99
24_D	34_R	0.555	0.99
68_R	75_Q	0.553	0.99
59_L	81_S	0.550	0.99
13_E	16_Q	0.548	0.99
13_E	85_G	0.544	0.99
32_G	113_R	0.540	0.99
11_L	81_S	0.533	0.99
20_V	113_R	0.529	0.99
112_N	115_R	0.526	0.99
10_V	97_L	0.522	0.99
104_R	108_F	0.521	0.99
32_G	36_D	0.518	0.99
105_L	109_M	0.516	0.99
62_K	78_F	0.516	0.99
23_K	93_E	0.513	0.99
29_D	117_I	0.510	0.99
49_I	53_T	0.508	0.99
5_G	75_Q	0.507	0.99
8_V	57_A	0.506	0.99
7_F	116_Q	0.505	0.99
75_Q	113_R	0.504	0.99
48_E	51_E	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cngA	4	0.9262	99.9	0.359	Contact Map
1vk6A	2	0.8523	99.9	0.379	Contact Map
3f6aA	2	0.8322	99.9	0.381	Contact Map
3fk9A	2	0.9463	99.9	0.386	Contact Map
4ickA	1	0.8658	99.9	0.387	Contact Map
2azwA	1	0.8188	99.9	0.387	Contact Map
3i7uA	4	0.8456	99.9	0.388	Contact Map
4dywA	2	0.8054	99.9	0.389	Contact Map
2qjtB	2	0.8322	99.9	0.389	Contact Map
3grnA	2	0.8389	99.9	0.391	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.