DLYKI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DLYKI - Probable D-lyxose ketol-isomerase

UniProt:	P96578	Sequences: MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFTDPRI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	167 (163)
Sequences:	105 (87)
Seq/√Len:	6.8

BACSU - DLYKI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_Y	153_S	3.701	0.93
53_Y	81_Q	3.365	0.89
81_Q	153_S	3.189	0.86
58_L	148_V	3.112	0.85
103_P	118_W	2.859	0.79
90_K	122_E	2.745	0.76
109_Q	112_R	2.636	0.73
90_K	124_E	2.516	0.69
12_Y	58_L	2.492	0.69
156_T	159_H	2.472	0.68
37_E	61_F	2.214	0.59
70_R	136_K	2.135	0.56
53_Y	131_I	2.132	0.56
111_D	166_R	2.075	0.54
15_A	19_L	1.989	0.50
7_E	38_R	1.949	0.49
40_V	107_P	1.878	0.46
107_P	111_D	1.869	0.46
11_Y	147_V	1.851	0.45
74_V	159_H	1.791	0.43
110_E	115_Y	1.777	0.42
14_K	48_V	1.768	0.42
8_V	58_L	1.726	0.41
104_K	119_H	1.713	0.40
36_K	39_K	1.704	0.40
44_L	115_Y	1.701	0.40
29_L	43_Q	1.694	0.39
40_V	115_Y	1.667	0.38
8_V	43_Q	1.627	0.37
97_G	120_E	1.607	0.36
6_E	148_V	1.595	0.36
40_V	111_D	1.549	0.34
13_Q	21_D	1.532	0.34
50_T	81_Q	1.510	0.33
5_K	9_N	1.499	0.33
94_Y	120_E	1.487	0.32
53_Y	132_P	1.483	0.32
65_T	94_Y	1.479	0.32
10_S	22_E	1.449	0.31
88_Y	147_V	1.448	0.31
103_P	107_P	1.444	0.31
100_T	107_P	1.436	0.31
20_T	127_G	1.433	0.31
24_V	136_K	1.421	0.30
50_T	53_Y	1.410	0.30
97_G	167_I	1.405	0.30
97_G	117_V	1.403	0.30
52_R	153_S	1.389	0.29
87_R	149_T	1.382	0.29
35_G	50_T	1.342	0.28
96_E	115_Y	1.334	0.27
36_K	40_V	1.329	0.27
131_I	153_S	1.319	0.27
86_C	91_V	1.310	0.27
8_V	12_Y	1.300	0.26
7_E	124_E	1.241	0.25
58_L	73_P	1.227	0.24
53_Y	73_P	1.146	0.22
13_Q	16_G	1.142	0.22
115_Y	131_I	1.132	0.22
8_V	113_E	1.119	0.21
37_E	43_Q	1.110	0.21
28_Q	105_V	1.088	0.21
117_V	153_S	1.073	0.20
8_V	29_L	1.072	0.20
103_P	111_D	1.069	0.20
24_V	43_Q	1.058	0.20
12_Y	134_N	1.058	0.20
124_E	136_K	1.055	0.20
46_V	156_T	1.052	0.20
22_E	26_Q	1.045	0.20
30_M	149_T	1.045	0.20
94_Y	97_G	1.039	0.19
51_D	154_T	1.037	0.19
84_F	150_E	1.030	0.19
68_E	141_A	1.026	0.19
68_E	136_K	1.024	0.19
10_S	14_K	1.021	0.19
105_V	140_Q	1.017	0.19
43_Q	88_Y	1.014	0.19
28_Q	41_G	1.010	0.19
101_P	107_P	1.005	0.19
86_C	125_P	1.002	0.19
112_R	125_P	1.000	0.19
44_L	59_V	0.998	0.19
97_G	119_H	0.984	0.18
24_V	135_T	0.971	0.18
16_G	73_P	0.971	0.18
29_L	37_E	0.967	0.18
36_K	88_Y	0.966	0.18
19_L	45_F	0.966	0.18
45_F	136_K	0.950	0.17
119_H	147_V	0.947	0.17
36_K	43_Q	0.944	0.17
45_F	103_P	0.941	0.17
24_V	166_R	0.927	0.17
81_Q	131_I	0.920	0.17
105_V	158_K	0.918	0.17
9_N	24_V	0.918	0.17
29_L	58_L	0.916	0.17
117_V	125_P	0.897	0.16
127_G	149_T	0.895	0.16
57_E	87_R	0.891	0.16
87_R	151_M	0.890	0.16
50_T	154_T	0.886	0.16
7_E	147_V	0.883	0.16
46_V	77_Q	0.881	0.16
43_Q	61_F	0.871	0.16
14_K	22_E	0.863	0.16
10_S	113_E	0.859	0.16
35_G	165_P	0.858	0.16
44_L	131_I	0.857	0.16
13_Q	24_V	0.850	0.15
78_E	164_D	0.845	0.15
40_V	53_Y	0.845	0.15
30_M	95_V	0.843	0.15
96_E	118_W	0.840	0.15
6_E	102_L	0.838	0.15
21_D	118_W	0.837	0.15
26_Q	90_K	0.831	0.15
38_R	159_H	0.828	0.15
55_S	165_P	0.827	0.15
54_C	150_E	0.819	0.15
65_T	95_V	0.816	0.15
60_L	93_L	0.811	0.15
60_L	110_E	0.810	0.15
10_S	134_N	0.808	0.15
42_L	116_T	0.797	0.14
15_A	24_V	0.795	0.14
28_Q	154_T	0.795	0.14
35_G	58_L	0.791	0.14
54_C	84_F	0.790	0.14
66_C	155_S	0.779	0.14
15_A	135_T	0.771	0.14
66_C	87_R	0.768	0.14
95_V	129_Y	0.763	0.14
10_S	143_E	0.762	0.14
13_Q	70_R	0.762	0.14
5_K	78_E	0.761	0.14
75_D	107_P	0.761	0.14
40_V	164_D	0.755	0.14
13_Q	153_S	0.750	0.14
92_Y	103_P	0.748	0.13
136_K	143_E	0.744	0.13
35_G	45_F	0.744	0.13
37_E	132_P	0.743	0.13
37_E	114_H	0.743	0.13
90_K	125_P	0.735	0.13
74_V	156_T	0.733	0.13
10_S	88_Y	0.729	0.13
92_Y	118_W	0.724	0.13
104_K	167_I	0.719	0.13
63_G	109_Q	0.717	0.13
5_K	122_E	0.713	0.13
91_V	161_I	0.709	0.13
49_N	155_S	0.704	0.13
113_E	154_T	0.702	0.13
25_D	143_E	0.695	0.13
9_N	132_P	0.693	0.13
14_K	88_Y	0.685	0.12
42_L	108_P	0.683	0.12
153_S	165_P	0.678	0.12
26_Q	121_I	0.672	0.12
29_L	166_R	0.669	0.12
58_L	132_P	0.660	0.12
10_S	26_Q	0.660	0.12
44_L	155_S	0.654	0.12
7_E	11_Y	0.653	0.12
61_F	76_G	0.647	0.12
38_R	96_E	0.646	0.12
105_V	113_E	0.646	0.12
81_Q	132_P	0.638	0.12
63_G	140_Q	0.636	0.12
15_A	43_Q	0.636	0.12
35_G	97_G	0.635	0.12
11_Y	18_V	0.631	0.12
61_F	112_R	0.627	0.11
25_D	161_I	0.627	0.11
66_C	150_E	0.623	0.11
37_E	76_G	0.622	0.11
90_K	144_E	0.620	0.11
96_E	132_P	0.620	0.11
51_D	77_Q	0.615	0.11
93_L	129_Y	0.613	0.11
43_Q	103_P	0.612	0.11
125_P	136_K	0.612	0.11
63_G	143_E	0.611	0.11
70_R	134_N	0.609	0.11
78_E	110_E	0.608	0.11
108_P	155_S	0.607	0.11
7_E	61_F	0.605	0.11
42_L	133_P	0.603	0.11
22_E	109_Q	0.600	0.11
19_L	29_L	0.594	0.11
66_C	84_F	0.592	0.11
54_C	66_C	0.591	0.11
73_P	144_E	0.589	0.11
14_K	50_T	0.589	0.11
51_D	166_R	0.586	0.11
40_V	154_T	0.586	0.11
11_Y	59_V	0.584	0.11
32_Y	42_L	0.583	0.11
10_S	31_D	0.581	0.11
57_E	66_C	0.578	0.11
154_T	159_H	0.578	0.11
74_V	97_G	0.577	0.11
121_I	131_I	0.576	0.11
36_K	148_V	0.566	0.11
93_L	135_T	0.564	0.11
53_Y	165_P	0.558	0.10
27_I	51_D	0.553	0.10
44_L	163_T	0.550	0.10
6_E	63_G	0.547	0.10
40_V	81_Q	0.542	0.10
5_K	25_D	0.540	0.10
52_R	76_G	0.539	0.10
43_Q	156_T	0.539	0.10
73_P	165_P	0.538	0.10
98_E	117_V	0.538	0.10
36_K	111_D	0.537	0.10
27_I	37_E	0.537	0.10
66_C	149_T	0.537	0.10
73_P	132_P	0.536	0.10
21_D	70_R	0.534	0.10
8_V	70_R	0.533	0.10
51_D	161_I	0.532	0.10
21_D	48_V	0.532	0.10
47_Y	57_E	0.525	0.10
18_V	164_D	0.524	0.10
59_V	134_N	0.522	0.10
29_L	154_T	0.520	0.10
27_I	30_M	0.520	0.10
94_Y	103_P	0.520	0.10
21_D	25_D	0.519	0.10
36_K	99_K	0.517	0.10
7_E	70_R	0.516	0.10
73_P	148_V	0.514	0.10
40_V	103_P	0.512	0.10
59_V	115_Y	0.508	0.10
37_E	45_F	0.507	0.10
62_P	129_Y	0.505	0.10
20_T	149_T	0.503	0.10
97_G	118_W	0.503	0.10
40_V	63_G	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2y0oA	2	0.994	100	0.516	Contact Map
3kmhA	2	0.9581	100	0.522	Contact Map
3h8uA	2	0.7126	98.3	0.899	Contact Map
2oa2A	2	0.6946	98	0.907	Contact Map
4zu4A	4	0.7844	97.9	0.907	Contact Map
1v70A	2	0.6228	97.9	0.909	Contact Map
3fjsA	2	0.6587	97.9	0.909	Contact Map
2pfwA	2	0.6707	97.8	0.91	Contact Map
3d0jA	2	0.7186	97.7	0.913	Contact Map
3l2hA	3	0.7784	97.7	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.