YVIE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVIE - Uncharacterized protein YviE

UniProt:	P96502	Sequences: MQIPRLIMHSVQGKIGLTTTPASLKMEQPQADLEIEQPSAEMEISVTPGKLTIDQTQAWEELDRKHVFKRIEEAAQQGHEDVMEGIARTAEEGDELMKIENKGNPIASQARRNSEMHQIQLGENYAPSLSRVKIQYTPSQLDVQITPRKPVIQAEPHKPIVEYTPGNVKVDMLQYPDLNIDVEYPKESPEK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	191 (179)
Sequences:	305 (259)
Seq/√Len:	19.4

BACSU - YVIE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
65_K	73_E	3.699	1.00
16_G	171_D	3.666	1.00
49_G	136_Y	3.555	1.00
46_V	141_L	3.335	1.00
8_M	178_L	3.186	0.99
172_M	175_Y	3.163	0.99
63_D	70_R	3.109	0.99
35_I	152_I	2.876	0.99
13_G	176_P	2.826	0.99
90_A	94_D	2.749	0.98
58_A	132_V	2.702	0.98
82_V	86_I	2.622	0.98
57_Q	133_K	2.589	0.98
85_G	89_T	2.575	0.98
61_E	131_R	2.469	0.97
51_L	136_Y	2.364	0.96
17_L	170_V	2.282	0.95
85_G	88_R	2.207	0.94
10_S	178_L	2.174	0.93
13_G	172_M	2.164	0.93
105_P	109_Q	2.039	0.91
59_W	62_L	1.983	0.90
56_T	69_K	1.945	0.89
16_G	173_L	1.937	0.89
27_E	160_I	1.862	0.86
57_Q	69_K	1.770	0.84
75_A	78_G	1.689	0.80
14_K	173_L	1.683	0.80
25_K	162_E	1.670	0.80
40_A	145_I	1.648	0.79
42_M	145_I	1.629	0.78
61_E	126_A	1.613	0.77
15_I	172_M	1.590	0.76
94_D	98_K	1.588	0.76
24_L	161_V	1.567	0.75
19_T	22_A	1.562	0.75
9_H	181_D	1.527	0.73
19_T	168_V	1.527	0.73
95_E	112_R	1.507	0.72
92_E	112_R	1.470	0.70
60_E	69_K	1.448	0.69
44_I	143_V	1.428	0.68
25_K	164_T	1.425	0.68
5_R	182_V	1.401	0.66
6_L	181_D	1.396	0.66
7_I	182_V	1.383	0.65
31_A	157_H	1.381	0.65
66_H	69_K	1.371	0.65
36_E	151_V	1.358	0.64
23_S	164_T	1.345	0.63
52_T	137_T	1.342	0.63
55_Q	59_W	1.294	0.60
62_L	126_A	1.246	0.57
22_A	170_V	1.244	0.57
63_D	92_E	1.228	0.56
171_D	175_Y	1.227	0.56
15_I	19_T	1.221	0.55
163_Y	166_G	1.212	0.55
7_I	10_S	1.205	0.54
60_E	73_E	1.201	0.54
32_D	157_H	1.190	0.54
123_E	160_I	1.185	0.53
8_M	182_V	1.182	0.53
124_N	127_P	1.149	0.51
28_Q	159_P	1.139	0.50
11_V	177_D	1.133	0.50
69_K	72_E	1.132	0.50
33_L	154_A	1.127	0.50
61_E	128_S	1.123	0.49
7_I	181_D	1.118	0.49
61_E	70_R	1.112	0.49
6_L	182_V	1.109	0.48
44_I	76_Q	1.108	0.48
46_V	139_S	1.101	0.48
95_E	109_Q	1.096	0.48
124_N	128_S	1.093	0.47
61_E	130_S	1.090	0.47
57_Q	61_E	1.061	0.45
18_T	169_K	1.052	0.45
26_M	159_P	1.047	0.44
121_L	124_N	1.029	0.43
5_R	181_D	1.025	0.43
14_K	175_Y	1.021	0.43
68_F	157_H	1.018	0.43
119_I	137_T	1.015	0.42
38_P	151_V	1.009	0.42
17_L	22_A	1.000	0.41
42_M	158_K	0.999	0.41
29_P	157_H	0.979	0.40
6_L	27_E	0.976	0.40
29_P	159_P	0.976	0.40
60_E	85_G	0.965	0.39
69_K	130_S	0.964	0.39
63_D	69_K	0.958	0.39
38_P	148_R	0.957	0.39
104_N	107_A	0.949	0.38
38_P	88_R	0.938	0.38
73_E	85_G	0.929	0.37
47_T	50_K	0.925	0.37
57_Q	60_E	0.924	0.37
104_N	169_K	0.921	0.37
79_H	83_M	0.920	0.37
18_T	165_P	0.910	0.36
97_M	148_R	0.905	0.36
72_E	90_A	0.903	0.36
24_L	165_P	0.902	0.36
61_E	125_Y	0.881	0.34
40_A	148_R	0.875	0.34
150_P	168_V	0.875	0.34
58_A	97_M	0.870	0.34
132_V	136_Y	0.857	0.33
28_Q	31_A	0.854	0.33
54_D	102_K	0.849	0.33
57_Q	96_L	0.847	0.32
65_K	131_R	0.846	0.32
56_T	66_H	0.818	0.31
151_V	154_A	0.817	0.31
102_K	137_T	0.814	0.31
159_P	168_V	0.808	0.30
92_E	166_G	0.804	0.30
85_G	150_P	0.803	0.30
34_E	82_V	0.801	0.30
30_Q	96_L	0.800	0.30
42_M	116_M	0.794	0.30
38_P	150_P	0.791	0.29
15_I	170_V	0.791	0.29
87_A	91_E	0.791	0.29
11_V	22_A	0.784	0.29
52_T	135_Q	0.779	0.29
176_P	179_N	0.770	0.28
19_T	161_V	0.770	0.28
47_T	138_P	0.769	0.28
4_P	28_Q	0.756	0.28
92_E	109_Q	0.754	0.27
34_E	155_E	0.752	0.27
75_A	90_A	0.750	0.27
12_Q	178_L	0.747	0.27
14_K	168_V	0.746	0.27
28_Q	113_N	0.741	0.27
65_K	70_R	0.740	0.27
59_W	66_H	0.732	0.26
127_P	131_R	0.730	0.26
46_V	145_I	0.728	0.26
56_T	132_V	0.726	0.26
22_A	161_V	0.724	0.26
85_G	166_G	0.724	0.26
6_L	82_V	0.723	0.26
55_Q	132_V	0.708	0.25
40_A	150_P	0.698	0.25
96_L	133_K	0.698	0.25
92_E	113_N	0.694	0.25
10_S	98_K	0.693	0.24
26_M	161_V	0.692	0.24
56_T	67_V	0.692	0.24
29_P	160_I	0.691	0.24
17_L	134_I	0.689	0.24
43_E	144_Q	0.687	0.24
118_Q	134_I	0.685	0.24
73_E	76_Q	0.682	0.24
69_K	73_E	0.681	0.24
84_E	91_E	0.680	0.24
53_I	168_V	0.677	0.24
9_H	182_V	0.674	0.24
22_A	162_E	0.674	0.24
23_S	161_V	0.673	0.24
67_V	72_E	0.670	0.23
25_K	77_Q	0.669	0.23
58_A	136_Y	0.668	0.23
31_A	154_A	0.665	0.23
37_Q	132_V	0.663	0.23
83_M	86_I	0.658	0.23
82_V	98_K	0.658	0.23
22_A	150_P	0.657	0.23
11_V	172_M	0.655	0.23
37_Q	127_P	0.652	0.23
24_L	172_M	0.650	0.22
54_D	96_L	0.648	0.22
39_S	149_K	0.647	0.22
42_M	164_T	0.646	0.22
96_L	129_L	0.640	0.22
81_D	85_G	0.638	0.22
94_D	102_K	0.634	0.22
46_V	138_P	0.633	0.22
59_W	131_R	0.632	0.22
3_I	6_L	0.627	0.21
55_Q	143_V	0.624	0.21
51_L	102_K	0.623	0.21
161_V	172_M	0.621	0.21
82_V	140_Q	0.614	0.21
50_K	57_Q	0.611	0.21
11_V	21_P	0.610	0.21
28_Q	132_V	0.610	0.21
61_E	74_A	0.607	0.21
25_K	45_S	0.604	0.21
43_E	172_M	0.604	0.21
153_Q	156_P	0.601	0.20
127_P	139_S	0.601	0.20
140_Q	167_N	0.597	0.20
10_S	86_I	0.593	0.20
22_A	166_G	0.593	0.20
55_Q	58_A	0.593	0.20
75_A	127_P	0.593	0.20
24_L	163_Y	0.590	0.20
126_A	131_R	0.590	0.20
3_I	7_I	0.588	0.20
89_T	94_D	0.587	0.20
6_L	136_Y	0.587	0.20
92_E	121_L	0.586	0.20
70_R	73_E	0.584	0.20
42_M	63_D	0.584	0.20
10_S	13_G	0.582	0.20
27_E	107_A	0.577	0.19
38_P	50_K	0.576	0.19
12_Q	169_K	0.576	0.19
103_G	106_I	0.575	0.19
42_M	84_E	0.574	0.19
25_K	85_G	0.574	0.19
91_E	175_Y	0.573	0.19
38_P	152_I	0.572	0.19
32_D	144_Q	0.572	0.19
137_T	140_Q	0.572	0.19
74_A	84_E	0.570	0.19
16_G	172_M	0.570	0.19
123_E	141_L	0.569	0.19
10_S	97_M	0.567	0.19
15_I	173_L	0.564	0.19
45_S	50_K	0.564	0.19
19_T	170_V	0.563	0.19
92_E	96_L	0.560	0.19
93_G	97_M	0.551	0.18
40_A	80_E	0.551	0.18
87_A	159_P	0.550	0.18
95_E	132_V	0.548	0.18
98_K	101_N	0.545	0.18
37_Q	40_A	0.544	0.18
33_L	146_T	0.544	0.18
96_L	105_P	0.543	0.18
29_P	32_D	0.542	0.18
125_Y	131_R	0.541	0.18
114_S	120_Q	0.539	0.18
74_A	81_D	0.539	0.18
36_E	149_K	0.539	0.18
31_A	56_T	0.538	0.18
174_Q	180_I	0.538	0.18
77_Q	81_D	0.535	0.18
20_T	135_Q	0.530	0.18
25_K	177_D	0.529	0.18
10_S	109_Q	0.527	0.17
68_F	71_I	0.526	0.17
21_P	161_V	0.525	0.17
96_L	153_Q	0.525	0.17
155_E	176_P	0.525	0.17
11_V	81_D	0.523	0.17
105_P	134_I	0.523	0.17
71_I	105_P	0.521	0.17
55_Q	64_R	0.521	0.17
11_V	164_T	0.521	0.17
79_H	86_I	0.521	0.17
67_V	71_I	0.521	0.17
144_Q	162_E	0.521	0.17
10_S	90_A	0.515	0.17
94_D	97_M	0.514	0.17
135_Q	179_N	0.511	0.17
104_N	108_S	0.511	0.17
55_Q	114_S	0.508	0.17
94_D	100_E	0.505	0.17
8_M	172_M	0.501	0.17
59_W	127_P	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1to2I	1	0.3298	6.7	0.96	Contact Map
2xcmC	1	0.4346	4.3	0.964	Contact Map
1rl1A	1	0.4293	4.2	0.964	Contact Map
1urqA	1	0.3037	3.8	0.965	Contact Map
3oonA	2	0.2565	3.6	0.965	Contact Map
1dwmA	1	0.3613	3.3	0.966	Contact Map
2ejxA	2	0.466	3	0.966	Contact Map
1vbwA	1	0.356	2.8	0.967	Contact Map
2rh0A	2	0.4817	2.7	0.967	Contact Map
3plvC	1	0.1047	2.6	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.