YWOB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWOB - Uncharacterized protein YwoB

UniProt:	P94572	Sequences: MMNKGGRLRKAVRKSIPATFRLFLAFNFFVYGLAKVVIGQFGEVTPEIEAAAGKGFTIAWTFFGYSHVYELFIGFGEILAAVLLLIPRTAALGAVIFMPIIVNIVLINYCFDIGVQDLSTILMVMCLILLWMDRRKFMGIFRQEPIDSRQVMKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (139)
Sequences:	233 (199)
Seq/√Len:	16.9

BACSU - YWOB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_A	85_L	4.857	1.00
105_V	109_Y	3.846	1.00
44_V	64_G	3.492	1.00
82_V	86_I	3.331	0.99
20_F	125_M	2.977	0.98
105_V	120_T	2.569	0.96
91_A	133_D	2.498	0.95
101_I	104_I	2.405	0.94
72_F	106_L	2.383	0.94
21_R	90_A	2.245	0.92
75_F	79_L	2.225	0.92
56_F	114_G	1.957	0.85
63_F	73_I	1.940	0.85
26_F	85_L	1.837	0.81
31_Y	56_F	1.831	0.81
44_V	119_S	1.821	0.81
20_F	128_I	1.809	0.80
48_I	52_A	1.800	0.80
24_L	97_F	1.755	0.78
36_V	78_I	1.724	0.77
109_Y	120_T	1.600	0.71
36_V	76_G	1.577	0.70
80_A	97_F	1.576	0.70
108_N	119_S	1.567	0.69
28_F	97_F	1.540	0.68
76_G	100_I	1.526	0.67
59_A	107_I	1.501	0.66
36_V	58_I	1.486	0.65
11_A	83_L	1.481	0.65
97_F	126_C	1.408	0.61
26_F	78_I	1.396	0.60
62_F	65_Y	1.386	0.60
55_G	114_G	1.360	0.58
41_F	60_W	1.354	0.58
68_V	110_C	1.336	0.57
20_F	129_L	1.323	0.56
113_I	116_Q	1.321	0.56
34_A	39_G	1.314	0.55
28_F	58_I	1.314	0.55
105_V	119_S	1.285	0.54
119_S	129_L	1.273	0.53
28_F	80_A	1.260	0.52
79_L	134_R	1.256	0.52
12_V	111_F	1.250	0.52
22_L	87_P	1.231	0.51
8_L	11_A	1.207	0.49
41_F	70_E	1.204	0.49
84_L	94_A	1.193	0.48
58_I	72_F	1.190	0.48
112_D	116_Q	1.181	0.48
66_S	102_V	1.153	0.46
16_I	19_T	1.145	0.45
139_G	143_Q	1.127	0.44
16_I	28_F	1.111	0.43
70_E	73_I	1.101	0.43
16_I	128_I	1.100	0.43
50_A	58_I	1.100	0.43
97_F	120_T	1.096	0.43
92_L	96_I	1.096	0.43
17_P	133_D	1.092	0.42
31_Y	122_L	1.079	0.42
31_Y	104_I	1.055	0.40
69_Y	77_E	1.054	0.40
76_G	102_V	1.053	0.40
87_P	111_F	1.048	0.40
60_W	115_V	1.036	0.39
44_V	108_N	1.033	0.39
60_W	112_D	1.026	0.39
41_F	63_F	1.025	0.38
138_M	142_R	1.023	0.38
64_G	122_L	1.001	0.37
32_G	78_I	1.000	0.37
96_I	143_Q	0.995	0.37
68_V	123_M	0.993	0.37
98_M	127_L	0.991	0.37
54_K	66_S	0.984	0.36
18_A	79_L	0.975	0.36
22_L	96_I	0.960	0.35
50_A	108_N	0.958	0.35
86_I	130_L	0.955	0.35
56_F	113_I	0.950	0.34
36_V	71_L	0.933	0.33
71_L	111_F	0.927	0.33
62_F	69_Y	0.923	0.33
51_A	108_N	0.913	0.32
96_I	119_S	0.893	0.31
27_N	121_I	0.871	0.30
22_L	100_I	0.869	0.30
59_A	62_F	0.858	0.30
112_D	115_V	0.839	0.29
38_I	57_T	0.834	0.28
133_D	136_K	0.829	0.28
69_Y	103_N	0.829	0.28
53_G	111_F	0.829	0.28
52_A	82_V	0.826	0.28
22_L	118_L	0.825	0.28
104_I	126_C	0.818	0.28
75_F	136_K	0.817	0.28
24_L	43_E	0.815	0.28
116_Q	122_L	0.809	0.27
12_V	46_P	0.808	0.27
74_G	77_E	0.807	0.27
78_I	82_V	0.805	0.27
29_F	78_I	0.802	0.27
117_D	140_I	0.802	0.27
118_L	121_I	0.795	0.27
100_I	103_N	0.794	0.27
20_F	51_A	0.789	0.26
7_R	11_A	0.788	0.26
38_I	70_E	0.780	0.26
114_G	117_D	0.778	0.26
18_A	72_F	0.777	0.26
25_A	129_L	0.765	0.25
28_F	81_A	0.759	0.25
73_I	115_V	0.758	0.25
104_I	136_K	0.758	0.25
104_I	107_I	0.756	0.25
131_W	135_R	0.754	0.25
51_A	112_D	0.752	0.25
16_I	111_F	0.751	0.25
107_I	113_I	0.749	0.24
54_K	113_I	0.746	0.24
58_I	103_N	0.745	0.24
101_I	116_Q	0.742	0.24
22_L	102_V	0.726	0.23
56_F	65_Y	0.725	0.23
18_A	52_A	0.723	0.23
72_F	80_A	0.720	0.23
23_F	111_F	0.714	0.23
72_F	76_G	0.711	0.23
56_F	60_W	0.698	0.22
76_G	80_A	0.694	0.22
23_F	27_N	0.686	0.22
23_F	64_G	0.679	0.22
54_K	114_G	0.674	0.21
32_G	36_V	0.673	0.21
7_R	99_P	0.668	0.21
71_L	102_V	0.668	0.21
60_W	95_V	0.665	0.21
97_F	100_I	0.665	0.21
56_F	140_I	0.660	0.21
36_V	102_V	0.659	0.21
55_G	66_S	0.658	0.21
20_F	50_A	0.658	0.21
80_A	90_A	0.658	0.21
21_R	84_L	0.655	0.21
14_K	59_A	0.653	0.21
37_V	133_D	0.653	0.21
90_A	96_I	0.647	0.20
24_L	81_A	0.643	0.20
25_A	88_R	0.640	0.20
31_Y	116_Q	0.635	0.20
127_L	131_W	0.633	0.20
124_V	142_R	0.633	0.20
139_G	144_E	0.630	0.20
38_I	41_F	0.626	0.19
85_L	88_R	0.622	0.19
59_A	70_E	0.621	0.19
29_F	81_A	0.614	0.19
61_T	125_M	0.614	0.19
10_K	13_R	0.612	0.19
51_A	116_Q	0.612	0.19
116_Q	132_M	0.606	0.19
42_G	70_E	0.606	0.19
44_V	122_L	0.604	0.19
12_V	16_I	0.601	0.19
24_L	126_C	0.596	0.18
47_E	79_L	0.596	0.18
17_P	129_L	0.595	0.18
84_L	93_G	0.595	0.18
67_H	125_M	0.591	0.18
6_G	10_K	0.589	0.18
64_G	91_A	0.588	0.18
67_H	77_E	0.579	0.18
30_V	45_T	0.578	0.18
12_V	131_W	0.576	0.18
98_M	130_L	0.574	0.18
55_G	115_V	0.572	0.18
92_L	110_C	0.570	0.17
22_L	143_Q	0.569	0.17
9_R	71_L	0.563	0.17
22_L	86_I	0.562	0.17
74_G	94_A	0.560	0.17
21_R	25_A	0.556	0.17
32_G	81_A	0.556	0.17
60_W	116_Q	0.555	0.17
19_T	81_A	0.552	0.17
56_F	112_D	0.547	0.17
8_L	99_P	0.547	0.17
22_L	103_N	0.543	0.17
39_G	104_I	0.541	0.17
50_A	92_L	0.540	0.16
80_A	101_I	0.540	0.16
127_L	137_F	0.540	0.16
58_I	65_Y	0.539	0.16
92_L	139_G	0.530	0.16
10_K	99_P	0.528	0.16
75_F	80_A	0.526	0.16
79_L	98_M	0.524	0.16
67_H	70_E	0.523	0.16
8_L	37_V	0.523	0.16
29_F	110_C	0.523	0.16
82_V	104_I	0.512	0.16
13_R	22_L	0.508	0.15
63_F	101_I	0.507	0.15
40_Q	74_G	0.504	0.15
85_L	118_L	0.504	0.15
7_R	73_I	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3w4tA	1	0.8831	8.3	0.955	Contact Map
4ev6A	3	0.461	6.4	0.957	Contact Map
4humA	1	0.9416	5.3	0.959	Contact Map
3j61U	1	0.2078	4.9	0.959	Contact Map
3mktA	1	0.9221	4.5	0.96	Contact Map
3b5dA	2	0.539	3.5	0.962	Contact Map
4lz6A	1	0.9026	3.2	0.963	Contact Map
4i0uA	4	0.4481	3.1	0.963	Contact Map
4wjvI	1	0.039	2.7	0.964	Contact Map
3j9pD	4	0.9091	1.9	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.