BCRC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BCRC - Undecaprenyl-diphosphatase BcrC

UniProt:	P94571	Sequences: MNYEIFKAIHGLSHHNSVLDSIMVFITEYAIVAYALILLAIWLFGNTQSRKHVLYAGITGIAGLVINYLITLVYFEPRPFVAHTVHTLIPHAADASFPSDHTTGALAISIAMLFRNRKIGWPLVIFGLLTGFSRIWVGHHYPVDVLGSLVVAIIIGFLFFRFSDLLRPFVDLVVRIYEAIINKLTKKPTDQNF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	193 (160)
Sequences:	7373 (5834)
Seq/√Len:	461.2

ECOLI - YBJG PGPB
BACSU - BCRC YODM
HALSA - Q9HRC2 Q9HNI3
SULSO - Q97VH2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
131_G	149_L	3.493	1.00
110_I	156_G	3.302	1.00
75_F	95_A	3.112	1.00
76_E	143_V	3.060	1.00
67_N	103_T	2.887	1.00
97_F	147_G	2.765	1.00
114_F	160_F	2.409	1.00
62_A	155_I	2.358	1.00
63_G	103_T	2.302	1.00
63_G	107_A	2.281	1.00
20_D	136_W	2.238	1.00
102_T	131_G	2.235	1.00
106_L	127_G	2.232	1.00
70_I	74_Y	2.217	1.00
106_L	149_L	2.052	1.00
31_I	35_A	2.006	1.00
102_T	106_L	1.922	1.00
106_L	131_G	1.883	1.00
148_S	152_A	1.860	1.00
23_M	132_F	1.845	1.00
110_I	153_I	1.825	1.00
46_N	49_S	1.817	1.00
113_L	120_G	1.785	1.00
31_I	34_Y	1.767	1.00
6_F	142_P	1.747	1.00
6_F	135_I	1.734	1.00
152_A	156_G	1.732	1.00
29_Y	126_F	1.713	1.00
131_G	145_V	1.711	1.00
27_T	133_S	1.706	1.00
59_T	107_A	1.668	1.00
109_S	127_G	1.645	1.00
157_F	161_R	1.644	1.00
8_A	12_L	1.571	1.00
26_I	129_L	1.549	1.00
135_I	145_V	1.516	1.00
105_A	130_T	1.511	1.00
32_V	35_A	1.484	1.00
55_Y	159_F	1.414	1.00
41_I	45_G	1.413	1.00
21_S	24_V	1.412	1.00
26_I	130_T	1.410	1.00
71_T	100_D	1.398	1.00
76_E	141_Y	1.385	1.00
102_T	149_L	1.379	1.00
23_M	133_S	1.354	1.00
96_S	144_D	1.259	1.00
16_N	19_L	1.258	1.00
113_L	123_L	1.217	1.00
67_N	100_D	1.207	1.00
120_G	123_L	1.204	1.00
19_L	23_M	1.191	1.00
70_I	98_P	1.176	1.00
32_V	36_L	1.165	1.00
98_P	151_V	1.163	1.00
15_H	20_D	1.163	1.00
74_Y	97_F	1.161	1.00
6_F	10_H	1.155	1.00
10_H	15_H	1.150	1.00
102_T	148_S	1.133	1.00
154_I	157_F	1.129	1.00
49_S	52_H	1.100	1.00
155_I	159_F	1.089	1.00
96_S	141_Y	1.087	1.00
103_T	151_V	1.083	1.00
92_A	139_H	1.081	1.00
127_G	149_L	1.077	1.00
135_I	142_P	1.070	1.00
68_Y	72_L	1.069	1.00
55_Y	111_A	1.052	1.00
109_S	123_L	1.043	1.00
27_T	137_V	1.040	1.00
21_S	25_F	1.037	1.00
18_V	22_I	1.027	1.00
102_T	145_V	1.022	1.00
30_A	130_T	1.009	1.00
9_I	12_L	1.008	1.00
153_I	157_F	1.006	1.00
42_W	45_G	1.003	1.00
114_F	156_G	1.002	1.00
105_A	127_G	0.998	1.00
72_L	95_A	0.988	1.00
110_I	152_A	0.985	1.00
69_L	73_V	0.981	1.00
83_H	86_H	0.977	1.00
109_S	126_F	0.971	1.00
121_W	125_I	0.958	1.00
98_P	147_G	0.953	1.00
5_I	8_A	0.948	1.00
77_P	81_V	0.944	1.00
124_V	127_G	0.940	1.00
65_V	69_L	0.936	1.00
133_S	137_V	0.935	1.00
56_A	111_A	0.934	1.00
64_L	68_Y	0.926	1.00
59_T	63_G	0.925	1.00
132_F	136_W	0.917	1.00
73_V	77_P	0.915	1.00
45_G	49_S	0.913	1.00
42_W	46_N	0.906	1.00
109_S	113_L	0.898	1.00
113_L	124_V	0.896	1.00
40_A	44_F	0.890	1.00
97_F	144_D	0.875	1.00
149_L	153_I	0.870	1.00
28_E	31_I	0.866	1.00
76_E	96_S	0.862	1.00
20_D	24_V	0.861	1.00
80_F	92_A	0.859	1.00
33_A	36_L	0.836	1.00
106_L	124_V	0.832	1.00
8_A	11_G	0.830	1.00
112_M	123_L	0.829	1.00
106_L	156_G	0.826	1.00
151_V	155_I	0.824	1.00
24_V	28_E	0.823	1.00
4_E	8_A	0.815	1.00
12_L	15_H	0.815	1.00
22_I	129_L	0.809	1.00
118_K	122_P	0.803	1.00
23_M	27_T	0.795	1.00
67_N	151_V	0.780	1.00
110_I	124_V	0.778	1.00
111_A	114_F	0.777	1.00
89_I	139_H	0.777	1.00
60_G	64_L	0.777	1.00
58_I	61_I	0.765	1.00
63_G	104_G	0.761	1.00
107_A	111_A	0.760	1.00
22_I	26_I	0.759	1.00
128_L	149_L	0.758	1.00
60_G	104_G	0.756	1.00
41_I	44_F	0.750	1.00
110_I	114_F	0.749	1.00
22_I	25_F	0.747	1.00
106_L	128_L	0.744	1.00
62_A	159_F	0.744	1.00
27_T	30_A	0.743	1.00
159_F	163_S	0.742	1.00
59_T	156_G	0.741	1.00
59_T	111_A	0.741	1.00
66_I	151_V	0.739	1.00
85_V	90_P	0.738	1.00
130_T	133_S	0.737	1.00
116_N	120_G	0.736	1.00
23_M	136_W	0.733	1.00
51_K	55_Y	0.732	1.00
44_F	49_S	0.719	1.00
70_I	151_V	0.719	1.00
142_P	146_L	0.718	1.00
7_K	11_G	0.716	1.00
63_G	155_I	0.716	1.00
5_I	142_P	0.716	1.00
71_T	78_R	0.711	1.00
103_T	155_I	0.705	1.00
25_F	28_E	0.703	1.00
139_H	142_P	0.694	1.00
20_D	23_M	0.688	1.00
60_G	108_I	0.686	1.00
102_T	105_A	0.686	1.00
12_L	17_S	0.684	1.00
9_I	135_I	0.684	1.00
27_T	139_H	0.684	1.00
103_T	148_S	0.682	1.00
105_A	109_S	0.681	1.00
80_F	141_Y	0.679	1.00
26_I	29_Y	0.678	1.00
83_H	87_T	0.678	1.00
126_F	130_T	0.677	1.00
100_D	104_G	0.670	1.00
76_E	144_D	0.670	1.00
31_I	36_L	0.669	1.00
111_A	160_F	0.669	1.00
77_P	82_A	0.664	1.00
80_F	139_H	0.652	1.00
31_I	100_D	0.644	1.00
114_F	157_F	0.643	1.00
17_S	21_S	0.634	0.99
66_I	155_I	0.634	0.99
63_G	67_N	0.631	0.99
101_H	140_H	0.630	0.99
86_H	90_P	0.628	0.99
59_T	159_F	0.627	0.99
119_I	123_L	0.627	0.99
39_L	42_W	0.624	0.99
80_F	91_H	0.618	0.99
147_G	150_V	0.617	0.99
111_A	156_G	0.615	0.99
12_L	132_F	0.613	0.99
150_V	153_I	0.610	0.99
83_H	90_P	0.609	0.99
19_L	136_W	0.609	0.99
10_H	138_G	0.606	0.99
105_A	126_F	0.600	0.99
33_A	37_I	0.599	0.99
37_I	40_A	0.598	0.99
106_L	153_I	0.597	0.99
34_Y	37_I	0.590	0.99
54_L	58_I	0.587	0.99
50_R	54_L	0.586	0.99
6_F	143_V	0.582	0.99
131_G	135_I	0.580	0.99
57_G	61_I	0.578	0.99
128_L	132_F	0.570	0.99
12_L	16_N	0.569	0.99
27_T	130_T	0.568	0.99
92_A	104_G	0.565	0.99
27_T	134_R	0.565	0.99
24_V	137_V	0.563	0.99
72_L	75_F	0.563	0.99
51_K	54_L	0.562	0.99
85_V	88_L	0.562	0.99
103_T	107_A	0.558	0.99
55_Y	114_F	0.554	0.99
58_I	163_S	0.554	0.99
122_P	125_I	0.551	0.99
159_F	162_F	0.548	0.99
160_F	164_D	0.546	0.98
4_E	7_K	0.545	0.98
66_I	69_L	0.544	0.98
56_A	60_G	0.543	0.98
129_L	133_S	0.542	0.98
10_H	20_D	0.541	0.98
55_Y	59_T	0.539	0.98
138_G	142_P	0.537	0.98
7_K	10_H	0.535	0.98
5_I	135_I	0.534	0.98
121_W	124_V	0.532	0.98
162_F	165_L	0.529	0.98
16_N	21_S	0.524	0.98
85_V	89_I	0.524	0.98
59_T	62_A	0.523	0.98
107_A	156_G	0.522	0.98
146_L	149_L	0.515	0.98
47_T	50_R	0.514	0.98
59_T	152_A	0.512	0.98
55_Y	163_S	0.508	0.98
27_T	105_A	0.507	0.98
64_L	67_N	0.502	0.97
94_D	100_D	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4px7A	1	0.9689	100	0.363	Contact Map
1d2tA	5	0.9275	99.9	0.434	Contact Map
4citA	1	0.886	99.9	0.445	Contact Map
2ipbA	2	0.9378	99.9	0.471	Contact Map
1qi9A	2	0.9896	99.9	0.481	Contact Map
1up8A	9	0.9275	99.9	0.495	Contact Map
3w36A	2	0.8705	99.9	0.5	Contact Map
3bb0A	1	0.9896	99.8	0.546	Contact Map
2kluA	1	0.2902	52.5	0.916	Contact Map
4mndA	2	0.8083	16.3	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.