YSNB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YSNB - Putative metallophosphoesterase YsnB

UniProt:	P94559	Sequences: MNVLIISDSHGLEEELQTIAKRHEAEVDLMIHCGDSELETRHPALEPYAVVKGNCDFAGDFKDELLLTAGSRKILVTHGHLHGIKQTLLNVYYRAEELGADVICFGHSHIAGSEVLRGKLMINPGSIRLPRVRRTESYAILTLENDAATVRFYDQAGNEIEDLQNRVTL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	169 (150)
Sequences:	4584 (3557)
Seq/√Len:	290.4

ECOLI - YFCE
BACSU - YSNB
HALSA - Q9HMP6 Q9HMV3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_C	104_C	3.912	1.00
122_I	139_A	3.905	1.00
31_I	76_V	3.719	1.00
113_S	120_L	2.931	1.00
29_L	49_A	2.870	1.00
4_L	27_V	2.540	1.00
74_I	102_V	2.508	1.00
22_R	138_Y	2.292	1.00
4_L	23_H	2.258	1.00
9_S	32_H	2.246	1.00
5_I	104_C	2.224	1.00
33_C	76_V	2.190	1.00
105_F	112_G	2.110	1.00
49_A	65_L	2.109	1.00
17_Q	44_A	2.102	1.00
9_S	127_I	2.075	1.00
72_R	101_D	2.052	1.00
75_L	100_A	2.044	1.00
5_I	141_L	1.872	1.00
7_S	33_C	1.780	1.00
58_A	62_K	1.747	1.00
2_N	142_T	1.658	1.00
111_A	137_S	1.625	1.00
105_F	121_M	1.623	1.00
20_A	44_A	1.601	1.00
68_T	73_K	1.561	1.00
6_I	16_L	1.502	1.00
27_V	140_I	1.465	1.00
73_K	101_D	1.452	1.00
108_S	123_N	1.408	1.00
13_E	40_T	1.405	1.00
36_S	50_V	1.390	1.00
39_E	43_P	1.371	1.00
30_M	48_Y	1.365	1.00
115_V	120_L	1.359	1.00
2_N	140_I	1.353	1.00
32_H	36_S	1.339	1.00
132_V	137_S	1.327	1.00
5_I	122_I	1.301	1.00
62_K	65_L	1.289	1.00
32_H	50_V	1.277	1.00
9_S	16_L	1.266	1.00
13_E	17_Q	1.264	1.00
17_Q	21_K	1.260	1.00
68_T	71_S	1.254	1.00
25_A	151_R	1.248	1.00
93_Y	97_E	1.247	1.00
124_P	139_A	1.225	1.00
4_L	138_Y	1.223	1.00
58_A	61_F	1.215	1.00
23_H	30_M	1.191	1.00
76_V	104_C	1.188	1.00
15_E	136_E	1.185	1.00
4_L	30_M	1.172	1.00
4_L	19_I	1.165	1.00
7_S	106_G	1.151	1.00
12_L	15_E	1.147	1.00
87_T	90_N	1.119	1.00
113_S	122_I	1.113	1.00
95_A	119_K	1.086	1.00
13_E	44_A	1.080	1.00
77_T	82_H	1.080	1.00
14_E	17_Q	1.079	1.00
67_L	74_I	1.069	1.00
3_V	29_L	1.068	1.00
18_T	22_R	1.058	1.00
38_L	41_R	1.048	1.00
23_H	27_V	1.047	1.00
12_L	128_R	1.031	1.00
104_C	141_L	1.028	1.00
6_I	19_I	1.027	1.00
126_S	130_P	1.025	1.00
70_G	143_L	1.025	1.00
37_E	55_C	1.019	1.00
77_T	81_L	1.018	1.00
103_I	119_K	1.011	1.00
62_K	66_L	1.010	1.00
57_F	84_I	1.008	1.00
65_L	76_V	0.990	1.00
66_L	100_A	0.983	1.00
66_L	73_K	0.975	1.00
102_V	120_L	0.974	1.00
6_I	32_H	0.974	1.00
113_S	150_V	0.973	1.00
142_T	149_T	0.973	1.00
142_T	151_R	0.971	1.00
5_I	31_I	0.953	1.00
130_P	136_E	0.949	1.00
38_L	42_H	0.948	1.00
19_I	23_H	0.945	1.00
104_C	122_I	0.944	1.00
72_R	146_D	0.940	1.00
54_N	107_H	0.937	1.00
23_H	138_Y	0.935	1.00
19_I	127_I	0.933	1.00
100_A	103_I	0.933	1.00
92_Y	116_L	0.928	1.00
95_A	103_I	0.908	1.00
29_L	69_A	0.897	1.00
115_V	118_G	0.888	1.00
126_S	131_R	0.883	1.00
64_E	75_L	0.883	1.00
127_I	138_Y	0.878	1.00
18_T	21_K	0.868	1.00
31_I	67_L	0.868	1.00
6_I	30_M	0.849	1.00
105_F	108_S	0.841	1.00
90_N	93_Y	0.834	1.00
72_R	102_V	0.831	1.00
87_T	91_V	0.831	1.00
45_L	61_F	0.829	1.00
116_L	119_K	0.828	1.00
64_E	94_R	0.826	1.00
79_G	108_S	0.823	1.00
10_H	109_H	0.810	1.00
4_L	140_I	0.809	1.00
96_E	117_R	0.807	1.00
111_A	134_R	0.801	0.99
36_S	41_R	0.800	0.99
144_E	147_A	0.795	0.99
84_I	105_F	0.783	0.99
6_I	9_S	0.780	0.99
52_K	57_F	0.777	0.99
70_G	146_D	0.767	0.99
137_S	152_F	0.763	0.99
55_C	129_L	0.755	0.99
42_H	46_E	0.753	0.99
8_D	109_H	0.748	0.99
6_I	127_I	0.747	0.99
89_L	93_Y	0.743	0.99
15_E	18_T	0.741	0.99
102_V	141_L	0.739	0.99
22_R	25_A	0.739	0.99
20_A	24_E	0.737	0.99
19_I	138_Y	0.734	0.99
39_E	58_A	0.733	0.99
86_Q	90_N	0.723	0.99
104_C	124_P	0.719	0.99
4_L	26_E	0.706	0.99
111_A	132_V	0.705	0.99
69_A	72_R	0.704	0.99
27_V	30_M	0.704	0.99
43_P	46_E	0.703	0.99
63_D	80_H	0.702	0.99
3_V	141_L	0.698	0.99
6_I	23_H	0.694	0.99
132_V	152_F	0.691	0.98
77_T	103_I	0.691	0.98
72_R	143_L	0.689	0.98
94_R	98_L	0.687	0.98
62_K	67_L	0.687	0.98
120_L	150_V	0.683	0.98
103_I	121_M	0.681	0.98
49_A	67_L	0.680	0.98
17_Q	40_T	0.679	0.98
74_I	104_C	0.668	0.98
61_F	65_L	0.660	0.98
29_L	47_P	0.655	0.98
21_K	24_E	0.654	0.98
67_L	76_V	0.653	0.98
92_Y	96_E	0.652	0.98
2_N	25_A	0.651	0.98
148_A	151_R	0.650	0.98
40_T	43_P	0.649	0.98
2_N	28_D	0.646	0.98
33_C	51_V	0.645	0.98
74_I	143_L	0.645	0.98
80_H	138_Y	0.641	0.98
88_L	114_E	0.634	0.97
61_F	66_L	0.633	0.97
106_G	124_P	0.626	0.97
19_I	22_R	0.618	0.97
36_S	61_F	0.618	0.97
88_L	92_Y	0.617	0.97
64_E	77_T	0.617	0.97
91_V	95_A	0.617	0.97
59_G	62_K	0.610	0.97
66_L	98_L	0.610	0.97
22_R	151_R	0.609	0.97
52_K	63_D	0.609	0.97
39_E	42_H	0.608	0.97
40_T	44_A	0.604	0.96
59_G	66_L	0.598	0.96
111_A	139_A	0.597	0.96
4_L	22_R	0.591	0.96
35_D	54_N	0.588	0.96
111_A	152_F	0.579	0.95
14_E	18_T	0.578	0.95
55_C	131_R	0.578	0.95
50_V	61_F	0.577	0.95
80_H	83_G	0.577	0.95
25_A	140_I	0.575	0.95
91_V	94_R	0.575	0.95
11_G	38_L	0.570	0.95
23_H	26_E	0.568	0.95
96_E	116_L	0.559	0.95
100_A	119_K	0.559	0.95
39_E	46_E	0.556	0.94
37_E	42_H	0.556	0.94
36_S	52_K	0.555	0.94
46_E	60_D	0.552	0.94
5_I	124_P	0.547	0.94
64_E	82_H	0.541	0.94
9_S	36_S	0.539	0.93
15_E	128_R	0.538	0.93
7_S	10_H	0.537	0.93
63_D	66_L	0.536	0.93
108_S	112_G	0.536	0.93
31_I	74_I	0.535	0.93
41_R	44_A	0.534	0.93
56_D	137_S	0.533	0.93
97_E	100_A	0.532	0.93
110_I	134_R	0.529	0.93
73_K	99_G	0.529	0.93
139_A	150_V	0.525	0.93
42_H	61_F	0.523	0.92
16_L	45_L	0.523	0.92
102_V	143_L	0.522	0.92
52_K	58_A	0.519	0.92
7_S	79_G	0.512	0.92
112_G	121_M	0.505	0.91
83_G	90_N	0.501	0.91
10_H	107_H	0.501	0.91
13_E	16_L	0.501	0.91
84_I	103_I	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1nnwA	2	1	100	0.327	Contact Map
3ck2A	1	1	100	0.333	Contact Map
3qfmA	2	1	100	0.36	Contact Map
3rqzA	1	0.9941	100	0.368	Contact Map
1z2wA	2	1	100	0.38	Contact Map
2a22A	1	1	100	0.391	Contact Map
1s3lA	1	0.858	100	0.41	Contact Map
2kknA	1	0.8639	100	0.411	Contact Map
1su1A	3	0.9172	100	0.435	Contact Map
1uf3A	6	0.8698	99.9	0.48	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.