FADR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FADR - Fatty acid metabolism regulator protein

UniProt:	P94548	Sequences: MKQKRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHNK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (181)
Sequences:	42155 (33096)
Seq/√Len:	2460.0

ECOLI - SLMA ACRR RUTR COMR ENVR UIDR NEMR FABR BETI BDCR YBIH YJDC RCDA
BACSU - FADR YHGD YVDT YFIR YXAF YVKB BSCR YTTP PKSA YEZE LMRA YDGC YVAF YDES YCNC YOBS YUXN YERO
HALSA - Q9HRF3
SULSO - Q97VV1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_S	40_D	3.974	1.00
22_N	31_K	3.936	1.00
17_E	35_Q	3.587	1.00
48_K	52_D	2.725	1.00
19_I	27_S	2.412	1.00
49_N	52_D	2.261	1.00
33_A	43_I	2.146	1.00
131_D	150_R	2.124	1.00
18_V	31_K	2.045	1.00
18_V	27_S	2.016	1.00
18_V	35_Q	2.013	1.00
82_K	136_E	1.981	1.00
21_E	35_Q	1.977	1.00
9_M	60_E	1.976	1.00
7_K	10_Q	1.957	1.00
14_A	35_Q	1.930	1.00
131_D	135_T	1.920	1.00
78_T	81_E	1.881	1.00
8_Y	56_S	1.876	1.00
30_S	34_K	1.859	1.00
10_Q	14_A	1.854	1.00
18_V	22_N	1.850	1.00
135_T	149_V	1.724	1.00
135_T	139_Q	1.701	1.00
14_A	17_E	1.700	1.00
39_A	42_T	1.652	1.00
16_V	60_E	1.619	1.00
9_M	13_D	1.618	1.00
135_T	138_I	1.590	1.00
12_I	56_S	1.590	1.00
29_V	44_Y	1.552	1.00
56_S	59_K	1.513	1.00
16_V	61_K	1.483	1.00
17_E	21_E	1.476	1.00
138_I	145_E	1.476	1.00
15_A	19_I	1.475	1.00
29_V	40_D	1.470	1.00
28_Q	31_K	1.464	1.00
31_K	35_Q	1.446	1.00
31_K	34_K	1.443	1.00
151_L	182_S	1.431	1.00
60_E	64_Q	1.412	1.00
70_E	129_I	1.399	1.00
155_M	159_T	1.381	1.00
27_S	32_I	1.375	1.00
16_V	57_L	1.371	1.00
55_I	59_K	1.365	1.00
84_A	181_N	1.358	1.00
23_G	27_S	1.353	1.00
47_F	56_S	1.348	1.00
6_P	10_Q	1.331	1.00
59_K	118_K	1.331	1.00
137_G	143_I	1.330	1.00
15_A	53_I	1.330	1.00
136_E	140_S	1.314	1.00
42_T	45_L	1.313	1.00
29_V	43_I	1.298	1.00
8_Y	46_Y	1.296	1.00
138_I	147_L	1.288	1.00
22_N	26_Q	1.275	1.00
13_D	60_E	1.270	1.00
80_K	84_A	1.250	1.00
14_A	18_V	1.247	1.00
88_S	180_S	1.224	1.00
84_A	88_S	1.204	1.00
23_G	26_Q	1.204	1.00
137_G	142_E	1.197	1.00
68_R	89_K	1.188	1.00
38_V	42_T	1.179	1.00
148_D	151_L	1.172	1.00
81_E	85_L	1.172	1.00
127_L	154_Q	1.168	1.00
55_I	118_K	1.148	1.00
88_S	177_V	1.142	1.00
39_A	45_L	1.133	1.00
175_D	178_A	1.129	1.00
82_K	133_I	1.121	1.00
52_D	56_S	1.113	1.00
51_E	55_I	1.096	1.00
127_L	131_D	1.095	1.00
40_D	44_Y	1.092	1.00
85_L	88_S	1.090	1.00
19_I	24_Y	1.088	1.00
88_S	181_N	1.088	1.00
41_G	45_L	1.079	1.00
44_Y	49_N	1.073	1.00
14_A	36_A	1.070	1.00
138_I	149_V	1.068	1.00
12_I	57_L	1.057	1.00
24_Y	54_L	1.047	1.00
32_I	53_I	1.046	1.00
144_K	147_L	1.042	1.00
12_I	47_F	1.029	1.00
129_I	132_G	1.025	1.00
16_V	20_A	1.025	1.00
66_I	125_G	1.018	1.00
78_T	142_E	1.017	1.00
6_P	9_M	1.015	1.00
133_I	137_G	1.012	1.00
43_I	53_I	1.009	1.00
13_D	17_E	1.007	1.00
118_K	121_E	1.004	1.00
77_A	85_L	1.003	1.00
42_T	46_Y	1.001	1.00
59_K	63_G	0.997	1.00
7_K	46_Y	0.989	1.00
52_D	55_I	0.982	1.00
84_A	184_L	0.978	1.00
15_A	57_L	0.976	1.00
22_N	35_Q	0.975	1.00
124_K	128_N	0.974	1.00
51_E	112_N	0.967	1.00
68_R	71_E	0.964	1.00
76_K	82_K	0.963	1.00
5_R	9_M	0.950	1.00
131_D	149_V	0.950	1.00
158_G	162_E	0.947	1.00
151_L	178_A	0.945	1.00
72_D	89_K	0.935	1.00
132_G	136_E	0.932	1.00
79_A	140_S	0.928	1.00
93_L	97_D	0.926	1.00
51_E	114_E	0.925	1.00
81_E	84_A	0.922	1.00
56_S	60_E	0.922	1.00
101_A	104_T	0.919	1.00
178_A	182_S	0.912	1.00
72_D	85_L	0.909	1.00
181_N	185_E	0.899	1.00
85_L	89_K	0.894	1.00
7_K	38_V	0.890	1.00
33_A	40_D	0.889	1.00
132_G	135_T	0.886	1.00
84_A	185_E	0.885	1.00
88_S	92_S	0.881	1.00
133_I	136_E	0.880	1.00
128_N	132_G	0.868	1.00
138_I	141_G	0.866	1.00
121_E	125_G	0.864	1.00
150_R	154_Q	0.863	1.00
138_I	143_I	0.857	1.00
89_K	92_S	0.856	1.00
18_V	21_E	0.854	1.00
60_E	63_G	0.853	1.00
61_K	64_Q	0.851	1.00
79_A	137_G	0.848	1.00
17_E	99_N	0.847	1.00
147_L	152_A	0.847	1.00
34_K	40_D	0.842	1.00
127_L	150_R	0.826	1.00
11_I	43_I	0.825	1.00
40_D	45_L	0.818	1.00
182_S	185_E	0.814	1.00
66_I	70_E	0.808	1.00
136_E	139_Q	0.803	1.00
117_Q	121_E	0.792	1.00
77_A	81_E	0.791	1.00
67_E	71_E	0.789	1.00
131_D	153_R	0.785	1.00
63_G	67_E	0.780	1.00
116_R	120_N	0.778	1.00
10_Q	36_A	0.774	1.00
177_V	181_N	0.774	1.00
10_Q	13_D	0.764	1.00
104_T	107_E	0.753	1.00
100_L	103_V	0.752	1.00
87_I	156_I	0.751	1.00
70_E	74_K	0.750	1.00
118_K	122_I	0.750	1.00
113_L	117_Q	0.743	1.00
102_I	105_Q	0.741	1.00
120_N	124_K	0.736	1.00
167_W	170_N	0.729	1.00
66_I	129_I	0.728	1.00
111_S	114_E	0.728	1.00
76_K	81_E	0.716	1.00
22_N	27_S	0.714	1.00
64_Q	67_E	0.707	1.00
12_I	60_E	0.702	1.00
125_G	129_I	0.702	1.00
134_L	149_V	0.698	1.00
11_I	36_A	0.689	1.00
180_S	184_L	0.687	1.00
151_L	155_M	0.679	1.00
182_S	186_L	0.678	1.00
75_E	85_L	0.675	1.00
128_N	131_D	0.674	1.00
95_A	176_L	0.658	1.00
134_L	138_I	0.656	1.00
12_I	16_V	0.656	1.00
30_S	44_Y	0.655	1.00
158_G	161_D	0.654	1.00
180_S	183_V	0.647	1.00
19_I	54_L	0.647	1.00
138_I	144_K	0.644	1.00
29_V	33_A	0.643	1.00
125_G	128_N	0.643	1.00
102_I	106_L	0.641	1.00
88_S	184_L	0.641	1.00
84_A	87_I	0.640	1.00
71_E	89_K	0.638	1.00
151_L	154_Q	0.637	1.00
76_K	85_L	0.636	1.00
92_S	177_V	0.635	1.00
176_L	180_S	0.634	1.00
24_Y	50_K	0.630	1.00
59_K	121_E	0.629	1.00
13_D	16_V	0.628	1.00
21_E	31_K	0.627	1.00
24_Y	51_E	0.624	1.00
36_A	39_A	0.624	1.00
92_S	180_S	0.618	1.00
179_L	183_V	0.616	1.00
134_L	156_I	0.614	1.00
155_M	158_G	0.610	1.00
25_H	107_E	0.604	1.00
7_K	42_T	0.603	1.00
106_L	110_Q	0.603	1.00
177_V	180_S	0.603	1.00
149_V	153_R	0.601	1.00
113_L	116_R	0.598	1.00
79_A	142_E	0.591	1.00
40_D	43_I	0.588	1.00
78_T	82_K	0.578	1.00
107_E	110_Q	0.578	1.00
67_E	70_E	0.577	1.00
92_S	96_G	0.574	1.00
90_H	94_L	0.574	1.00
11_I	46_Y	0.571	1.00
117_Q	120_N	0.570	1.00
25_H	110_Q	0.570	1.00
80_K	142_E	0.569	1.00
29_V	50_K	0.566	1.00
87_I	90_H	0.562	1.00
174_Y	177_V	0.561	1.00
101_A	105_Q	0.555	1.00
174_Y	178_A	0.554	1.00
38_V	46_Y	0.551	1.00
134_L	152_A	0.545	1.00
59_K	122_I	0.545	1.00
158_G	166_T	0.543	1.00
148_D	182_S	0.540	1.00
120_N	123_L	0.539	1.00
71_E	75_E	0.539	1.00
24_Y	27_S	0.538	1.00
137_G	141_G	0.536	1.00
7_K	39_A	0.535	1.00
15_A	32_I	0.533	1.00
143_I	148_D	0.532	1.00
112_N	115_L	0.532	1.00
55_I	117_Q	0.529	1.00
33_A	38_V	0.525	1.00
107_E	111_S	0.524	1.00
82_K	137_G	0.524	1.00
179_L	182_S	0.524	1.00
72_D	75_E	0.523	1.00
63_G	122_I	0.522	1.00
178_A	181_N	0.521	1.00
62_M	122_I	0.521	1.00
68_R	93_L	0.521	1.00
145_E	148_D	0.521	1.00
176_L	179_L	0.519	1.00
166_T	170_N	0.519	1.00
181_N	184_L	0.516	1.00
5_R	8_Y	0.515	1.00
73_I	129_I	0.512	1.00
159_T	183_V	0.512	1.00
92_S	176_L	0.508	1.00
103_V	106_L	0.503	1.00
64_Q	68_R	0.503	1.00
135_T	150_R	0.503	1.00
62_M	125_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vi0A	2	0.9742	100	0.183	Contact Map
2ibdA	2	0.9845	100	0.187	Contact Map
4udsA	2	0.9536	100	0.194	Contact Map
3dcfA	2	0.9433	100	0.208	Contact Map
3nrgA	2	1	100	0.212	Contact Map
3npiA	2	0.9845	100	0.212	Contact Map
2xdnA	2	0.9897	100	0.213	Contact Map
4gckA	2	0.9691	100	0.215	Contact Map
4jykA	2	0.9897	100	0.217	Contact Map
3anpC	2	0.9948	100	0.217	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.