YNAE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNAE - Uncharacterized protein YnaE

UniProt:	P94483	Sequences: MNLIGYIEERFQNLELIPSIYNQWGTGIHFCLGENIYQLKANEELNLKMFRIVYEQTSIIFNELFEQNDDIFLVTNMYKHKKKEKCIRKLKVYQPFLKCKNHLNQIMVKTYPYPFEINKAEEYEMQQFSLLCKPRDLRVTELLKAASNEDFPQKPKFGGYSIDYPDVFFVNITKDIIFFIYDDRGCEVIAHDFKRIRPLYEKYHDWVEEYKCM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	213 (193)
Sequences:	149 (124)
Seq/√Len:	8.9

BACSU - YNAE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_I	207_V	5.275	1.00
187_E	208_E	3.476	0.95
143_L	180_I	3.316	0.94
22_N	211_K	3.137	0.92
29_H	56_Q	3.117	0.92
146_A	179_F	2.952	0.89
30_F	200_Y	2.923	0.89
49_M	150_D	2.922	0.89
200_Y	210_Y	2.864	0.88
60_I	188_V	2.718	0.85
188_V	199_L	2.672	0.84
29_H	187_E	2.579	0.82
29_H	208_E	2.531	0.80
61_F	169_F	2.482	0.79
56_Q	187_E	2.428	0.77
148_N	155_P	2.328	0.74
187_E	211_K	2.267	0.72
32_L	180_I	2.235	0.71
76_N	168_F	2.231	0.71
32_L	53_V	2.164	0.69
21_Y	187_E	2.140	0.68
208_E	211_K	2.136	0.67
22_N	187_E	2.124	0.67
32_L	155_P	2.049	0.64
31_C	210_Y	2.042	0.64
75_T	93_Y	1.958	0.60
22_N	208_E	1.936	0.59
22_N	29_H	1.935	0.59
56_Q	208_E	1.887	0.57
157_F	168_F	1.852	0.56
120_A	167_V	1.832	0.55
65_F	176_I	1.793	0.53
72_F	172_I	1.741	0.51
147_S	180_I	1.679	0.48
19_S	187_E	1.658	0.48
29_H	37_Y	1.650	0.47
50_F	65_F	1.631	0.46
65_F	151_F	1.629	0.46
19_S	29_H	1.618	0.46
200_Y	206_W	1.580	0.44
46_N	167_V	1.572	0.44
50_F	151_F	1.540	0.43
18_P	24_W	1.503	0.41
106_I	130_L	1.452	0.39
24_W	189_I	1.439	0.38
91_K	95_P	1.437	0.38
132_C	136_D	1.406	0.37
32_L	190_A	1.402	0.37
60_I	196_I	1.386	0.36
96_F	106_I	1.360	0.35
99_C	104_N	1.338	0.34
56_Q	206_W	1.324	0.34
19_S	56_Q	1.314	0.33
29_H	200_Y	1.288	0.32
16_L	127_Q	1.282	0.32
61_F	148_N	1.265	0.31
24_W	132_C	1.229	0.30
146_A	169_F	1.215	0.30
11_F	155_P	1.214	0.30
61_F	175_D	1.192	0.29
190_A	200_Y	1.186	0.29
125_M	166_D	1.170	0.28
117_I	192_D	1.162	0.28
14_L	130_L	1.156	0.28
116_E	196_I	1.145	0.27
64_L	176_I	1.107	0.26
21_Y	27_G	1.098	0.26
58_S	144_K	1.094	0.25
77_M	95_P	1.094	0.25
55_E	82_K	1.081	0.25
52_I	137_L	1.071	0.25
14_L	170_V	1.068	0.25
118_N	121_E	1.065	0.25
62_N	169_F	1.056	0.24
20_I	189_I	1.055	0.24
150_D	154_K	1.045	0.24
47_L	71_I	1.042	0.24
60_I	169_F	1.035	0.24
170_V	177_I	1.032	0.23
24_W	177_I	1.030	0.23
60_I	82_K	1.018	0.23
21_Y	29_H	1.009	0.23
69_D	197_R	1.007	0.23
30_F	125_M	1.007	0.23
19_S	208_E	0.997	0.22
62_N	139_V	0.995	0.22
56_Q	190_A	0.995	0.22
14_L	24_W	0.993	0.22
29_H	181_Y	0.990	0.22
199_L	205_D	0.986	0.22
29_H	211_K	0.974	0.22
58_S	168_F	0.966	0.22
179_F	187_E	0.964	0.21
114_P	192_D	0.963	0.21
146_A	157_F	0.961	0.21
56_Q	127_Q	0.952	0.21
63_E	203_Y	0.949	0.21
11_F	203_Y	0.945	0.21
21_Y	56_Q	0.940	0.21
73_L	137_L	0.939	0.21
20_I	106_I	0.934	0.21
68_N	94_Q	0.932	0.21
19_S	22_N	0.931	0.21
24_W	186_C	0.930	0.20
14_L	18_P	0.930	0.20
137_L	189_I	0.929	0.20
182_D	185_G	0.929	0.20
49_M	52_I	0.923	0.20
197_R	203_Y	0.902	0.20
20_I	28_I	0.901	0.20
174_K	190_A	0.875	0.19
71_I	157_F	0.875	0.19
71_I	134_P	0.871	0.19
60_I	147_S	0.869	0.19
142_L	180_I	0.863	0.19
97_L	193_F	0.861	0.19
190_A	197_R	0.858	0.19
187_E	200_Y	0.850	0.18
169_F	203_Y	0.849	0.18
28_I	53_V	0.838	0.18
36_I	49_M	0.835	0.18
75_T	92_V	0.833	0.18
69_D	151_F	0.828	0.18
96_F	132_C	0.825	0.18
190_A	206_W	0.823	0.18
196_I	200_Y	0.821	0.18
100_K	169_F	0.820	0.18
8_E	209_E	0.819	0.18
27_G	189_I	0.815	0.17
59_I	119_K	0.811	0.17
17_I	20_I	0.804	0.17
33_G	131_L	0.802	0.17
7_I	25_G	0.801	0.17
58_S	71_I	0.799	0.17
197_R	201_E	0.799	0.17
21_Y	208_E	0.793	0.17
110_T	113_Y	0.791	0.17
137_L	192_D	0.789	0.17
74_V	170_V	0.785	0.17
143_L	188_V	0.783	0.17
8_E	137_L	0.783	0.17
14_L	31_C	0.781	0.17
36_I	94_Q	0.776	0.16
81_K	120_A	0.772	0.16
108_V	143_L	0.770	0.16
189_I	196_I	0.769	0.16
19_S	196_I	0.768	0.16
112_P	115_F	0.768	0.16
25_G	197_R	0.765	0.16
157_F	164_Y	0.765	0.16
145_A	150_D	0.763	0.16
11_F	197_R	0.762	0.16
143_L	199_L	0.756	0.16
22_N	30_F	0.753	0.16
120_A	188_V	0.750	0.16
75_T	149_E	0.749	0.16
17_I	53_V	0.747	0.16
30_F	199_L	0.746	0.16
111_Y	121_E	0.739	0.16
157_F	176_I	0.734	0.15
60_I	94_Q	0.732	0.15
93_Y	101_N	0.731	0.15
191_H	197_R	0.729	0.15
139_V	169_F	0.728	0.15
20_I	96_F	0.725	0.15
200_Y	208_E	0.723	0.15
22_N	200_Y	0.716	0.15
29_H	165_P	0.714	0.15
91_K	97_L	0.710	0.15
55_E	143_L	0.707	0.15
165_P	186_C	0.702	0.15
186_C	189_I	0.699	0.15
37_Y	46_N	0.693	0.15
147_S	186_C	0.692	0.15
73_L	202_K	0.691	0.15
69_D	150_D	0.690	0.15
94_Q	119_K	0.688	0.14
145_A	177_I	0.686	0.14
76_N	127_Q	0.682	0.14
137_L	173_T	0.680	0.14
29_H	78_Y	0.680	0.14
110_T	209_E	0.677	0.14
25_G	110_T	0.674	0.14
33_G	49_M	0.672	0.14
180_I	186_C	0.671	0.14
188_V	205_D	0.667	0.14
69_D	174_K	0.667	0.14
197_R	210_Y	0.662	0.14
96_F	147_S	0.662	0.14
39_L	45_L	0.657	0.14
20_I	187_E	0.657	0.14
25_G	166_D	0.656	0.14
29_H	39_L	0.655	0.14
142_L	164_Y	0.655	0.14
18_P	76_N	0.653	0.14
13_N	118_N	0.651	0.14
13_N	134_P	0.650	0.14
36_I	207_V	0.649	0.14
23_Q	187_E	0.648	0.14
20_I	27_G	0.647	0.14
37_Y	152_P	0.645	0.14
13_N	121_E	0.645	0.14
72_F	129_S	0.645	0.14
73_L	138_R	0.640	0.13
136_D	148_N	0.637	0.13
165_P	187_E	0.637	0.13
105_Q	127_Q	0.636	0.13
113_Y	155_P	0.634	0.13
145_A	170_V	0.632	0.13
145_A	171_N	0.629	0.13
73_L	94_Q	0.627	0.13
53_V	69_D	0.626	0.13
14_L	167_V	0.626	0.13
22_N	56_Q	0.625	0.13
12_Q	62_N	0.624	0.13
67_Q	169_F	0.624	0.13
165_P	208_E	0.622	0.13
37_Y	151_F	0.621	0.13
24_W	27_G	0.619	0.13
49_M	89_K	0.618	0.13
174_K	194_K	0.609	0.13
70_D	156_K	0.609	0.13
57_T	148_N	0.608	0.13
30_F	196_I	0.607	0.13
71_I	169_F	0.606	0.13
151_F	176_I	0.606	0.13
102_H	119_K	0.605	0.13
57_T	176_I	0.604	0.13
97_L	168_F	0.603	0.13
75_T	154_K	0.603	0.13
26_T	73_L	0.603	0.13
17_I	119_K	0.600	0.13
30_F	33_G	0.596	0.13
29_H	53_V	0.591	0.13
50_F	165_P	0.590	0.13
165_P	180_I	0.590	0.13
18_P	186_C	0.586	0.12
148_N	167_V	0.586	0.12
146_A	167_V	0.584	0.12
28_I	186_C	0.583	0.12
130_L	196_I	0.582	0.12
31_C	185_G	0.582	0.12
8_E	88_R	0.580	0.12
28_I	59_I	0.579	0.12
75_T	85_K	0.576	0.12
151_F	165_P	0.574	0.12
66_E	81_K	0.574	0.12
19_S	27_G	0.573	0.12
56_Q	165_P	0.567	0.12
127_Q	203_Y	0.567	0.12
70_D	136_D	0.564	0.12
20_I	200_Y	0.563	0.12
21_Y	189_I	0.563	0.12
54_Y	138_R	0.558	0.12
49_M	82_K	0.554	0.12
69_D	96_F	0.544	0.12
50_F	155_P	0.543	0.12
100_K	112_P	0.543	0.12
21_Y	211_K	0.542	0.12
32_L	178_F	0.541	0.12
177_I	188_V	0.539	0.12
11_F	92_V	0.537	0.12
29_H	164_Y	0.536	0.12
164_Y	168_F	0.536	0.12
171_N	177_I	0.534	0.11
7_I	66_E	0.533	0.11
12_Q	113_Y	0.533	0.11
150_D	171_N	0.532	0.11
46_N	104_N	0.532	0.11
51_R	205_D	0.532	0.11
54_Y	64_L	0.525	0.11
110_T	154_K	0.524	0.11
11_F	14_L	0.522	0.11
29_H	210_Y	0.521	0.11
14_L	178_F	0.521	0.11
14_L	71_I	0.520	0.11
54_Y	60_I	0.519	0.11
21_Y	186_C	0.519	0.11
20_I	208_E	0.518	0.11
27_G	52_I	0.517	0.11
190_A	196_I	0.510	0.11
74_V	194_K	0.509	0.11
65_F	165_P	0.508	0.11
8_E	52_I	0.507	0.11
16_L	20_I	0.506	0.11
82_K	178_F	0.504	0.11
66_E	124_E	0.503	0.11
93_Y	96_F	0.501	0.11
20_I	196_I	0.500	0.11
19_S	189_I	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bcgG	1	0.3239	9.4	0.962	Contact Map
3w1oA	2	0.3474	6.8	0.965	Contact Map
2gx5A	2	0.3897	6.3	0.965	Contact Map
2n2hB	1	0.446	6.2	0.966	Contact Map
1v5rA	1	0.1549	6.1	0.966	Contact Map
1x4tA	1	0.1784	3.8	0.969	Contact Map
3p1wA	1	0.2958	3.4	0.97	Contact Map
1egxA	1	0.2394	3	0.97	Contact Map
3kkiA	2	0.2723	2.6	0.971	Contact Map
4fhdA	1	0.2958	2.3	0.972	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.