YCGL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YCGL - Uncharacterized protein YcgL

UniProt:	P94389	Sequences: MKQRIIDELKRIEQSYGVKIVYAVESGSRAWGFPSQDSDYDVRFIYVPKKEWYFSIEQERDVIEEPIHDLLDISGWELRKTLRLFKKSNPPLLEWLSSDIVYYEAFTTAEQLRKLRTEAFKPEASVYHYINMARRNVKDYLQGQEVKIKKYFYVLRPILACQWIEKHGTIPPMDFTVLMNELVAEPELKAEMETLLERKRRGEELDLEARIDVIHQFIETEIERIMEAAKELKAEKKDMTSELNRLLLNTVEEVWKDGGS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	260 (211)
Sequences:	1039 (687)
Seq/√Len:	47.3

BACSU - YCGL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
174_D	177_V	3.749	1.00
16_Y	48_P	3.181	1.00
221_E	224_R	2.955	1.00
162_Q	166_K	2.949	1.00
162_Q	221_E	2.686	1.00
120_F	164_I	2.558	1.00
48_P	77_E	2.491	1.00
213_V	216_Q	2.471	1.00
181_E	184_A	2.441	1.00
218_I	222_I	2.305	1.00
133_A	158_I	2.302	1.00
136_N	154_V	2.253	1.00
172_P	175_F	2.239	1.00
176_T	180_N	2.206	1.00
213_V	218_I	2.167	1.00
22_Y	45_I	2.139	1.00
194_T	197_E	2.136	1.00
158_I	218_I	2.087	1.00
140_Y	151_Y	2.076	1.00
205_L	208_E	2.041	1.00
33_F	153_Y	1.958	0.99
60_R	64_E	1.955	0.99
60_R	63_I	1.937	0.99
176_T	200_R	1.937	0.99
46_Y	75_G	1.915	0.99
29_R	40_Y	1.901	0.99
21_V	108_T	1.895	0.99
17_G	49_K	1.856	0.99
191_E	213_V	1.748	0.98
154_V	158_I	1.692	0.98
104_E	109_A	1.676	0.98
62_V	66_P	1.675	0.98
84_L	89_N	1.645	0.98
109_A	113_R	1.620	0.97
214_I	217_F	1.613	0.97
217_F	221_E	1.594	0.97
163_W	172_P	1.587	0.97
202_G	205_L	1.575	0.97
133_A	154_V	1.575	0.97
150_K	154_V	1.553	0.97
203_E	206_D	1.533	0.96
139_D	142_Q	1.528	0.96
137_V	215_H	1.524	0.96
212_D	218_I	1.522	0.96
33_F	152_F	1.512	0.96
44_F	75_G	1.507	0.96
56_I	86_K	1.480	0.96
190_A	193_E	1.474	0.96
29_R	53_Y	1.472	0.95
80_K	83_R	1.433	0.95
221_E	225_I	1.431	0.95
110_E	114_K	1.426	0.95
214_I	218_I	1.418	0.94
37_D	204_E	1.402	0.94
25_E	29_R	1.387	0.94
48_P	52_W	1.382	0.94
29_R	43_R	1.376	0.93
148_I	208_E	1.375	0.93
211_I	215_H	1.365	0.93
202_G	208_E	1.353	0.93
104_E	113_R	1.347	0.93
132_M	136_N	1.346	0.93
26_S	153_Y	1.346	0.93
23_A	75_G	1.341	0.93
24_V	98_S	1.334	0.92
28_S	41_D	1.325	0.92
212_D	216_Q	1.319	0.92
47_V	78_L	1.315	0.92
57_E	86_K	1.314	0.92
134_R	226_M	1.301	0.91
58_Q	79_R	1.284	0.91
218_I	221_E	1.281	0.91
25_E	102_Y	1.253	0.90
42_V	161_C	1.253	0.90
43_R	76_W	1.250	0.90
165_E	224_R	1.237	0.89
18_V	63_I	1.236	0.89
38_S	43_R	1.235	0.89
96_L	116_R	1.235	0.89
179_M	183_V	1.228	0.89
98_S	195_L	1.228	0.89
43_R	94_E	1.228	0.89
180_N	183_V	1.226	0.89
191_E	194_T	1.215	0.88
220_T	224_R	1.199	0.88
109_A	112_L	1.199	0.88
215_H	219_E	1.173	0.86
15_S	65_E	1.155	0.86
35_S	153_Y	1.140	0.85
98_S	101_V	1.138	0.85
169_T	172_P	1.125	0.84
188_L	196_L	1.120	0.84
210_R	218_I	1.107	0.83
74_S	77_E	1.100	0.83
219_E	222_I	1.097	0.83
61_D	80_K	1.082	0.82
210_R	215_H	1.075	0.81
146_V	151_Y	1.073	0.81
106_F	110_E	1.073	0.81
202_G	206_D	1.067	0.81
33_F	37_D	1.064	0.81
216_Q	220_T	1.062	0.80
45_I	81_T	1.060	0.80
137_V	154_V	1.056	0.80
31_W	38_S	1.032	0.78
168_G	225_I	1.032	0.78
43_R	80_K	1.029	0.78
25_E	31_W	1.020	0.78
65_E	183_V	1.005	0.77
29_R	38_S	1.001	0.76
16_Y	112_L	0.997	0.76
213_V	219_E	0.997	0.76
97_S	173_M	0.992	0.76
29_R	102_Y	0.991	0.76
161_C	221_E	0.991	0.76
125_S	164_I	0.990	0.76
61_D	76_W	0.987	0.75
32_G	43_R	0.982	0.75
57_E	73_I	0.964	0.74
38_S	94_E	0.960	0.73
58_Q	83_R	0.959	0.73
26_S	37_D	0.956	0.73
117_T	201_R	0.956	0.73
108_T	115_L	0.952	0.73
99_D	102_Y	0.952	0.73
197_E	200_R	0.952	0.73
54_F	72_D	0.948	0.72
162_Q	198_R	0.947	0.72
223_E	226_M	0.946	0.72
88_S	125_S	0.945	0.72
40_Y	53_Y	0.944	0.72
111_Q	186_P	0.941	0.72
84_L	90_P	0.932	0.71
42_V	102_Y	0.930	0.71
198_R	208_E	0.928	0.71
193_E	196_L	0.927	0.71
45_I	111_Q	0.920	0.70
129_Y	160_A	0.917	0.70
26_S	33_F	0.916	0.70
136_N	140_Y	0.912	0.69
26_S	95_W	0.910	0.69
90_P	121_K	0.894	0.68
153_Y	204_E	0.886	0.67
219_E	223_E	0.879	0.66
23_A	46_Y	0.876	0.66
39_D	72_D	0.874	0.66
24_V	99_D	0.859	0.65
19_K	47_V	0.854	0.64
197_E	201_R	0.851	0.64
53_Y	95_W	0.849	0.64
39_D	149_K	0.848	0.64
79_R	83_R	0.842	0.63
187_E	190_A	0.836	0.63
138_K	154_V	0.835	0.62
28_S	39_D	0.829	0.62
110_E	216_Q	0.827	0.62
93_L	119_A	0.825	0.62
161_C	225_I	0.824	0.61
194_T	198_R	0.821	0.61
19_K	110_E	0.810	0.60
24_V	95_W	0.810	0.60
139_D	215_H	0.809	0.60
15_S	176_T	0.807	0.60
34_P	37_D	0.805	0.60
61_D	160_A	0.805	0.60
24_V	29_R	0.805	0.60
30_A	173_M	0.803	0.59
41_D	149_K	0.797	0.59
190_A	197_E	0.791	0.58
120_F	123_E	0.784	0.58
34_P	148_I	0.782	0.57
170_I	173_M	0.779	0.57
16_Y	49_K	0.779	0.57
176_T	197_E	0.779	0.57
38_S	133_A	0.776	0.57
50_K	73_I	0.773	0.57
52_W	59_E	0.772	0.56
63_I	82_L	0.769	0.56
38_S	41_D	0.768	0.56
155_L	188_L	0.761	0.55
40_Y	102_Y	0.757	0.55
20_I	75_G	0.755	0.55
40_Y	63_I	0.753	0.55
29_R	34_P	0.750	0.54
26_S	43_R	0.748	0.54
15_S	118_E	0.748	0.54
102_Y	204_E	0.747	0.54
178_L	184_A	0.734	0.53
74_S	81_T	0.732	0.52
72_D	149_K	0.729	0.52
89_N	149_K	0.725	0.52
209_A	212_D	0.723	0.52
197_E	216_Q	0.723	0.52
151_Y	210_R	0.710	0.50
26_S	160_A	0.705	0.50
81_T	85_F	0.703	0.50
210_R	213_V	0.701	0.49
100_I	131_N	0.698	0.49
54_F	61_D	0.697	0.49
197_E	223_E	0.692	0.48
35_S	199_K	0.691	0.48
152_F	157_P	0.686	0.48
37_D	153_Y	0.685	0.48
68_H	73_I	0.682	0.47
92_L	125_S	0.679	0.47
137_V	192_M	0.676	0.47
108_T	112_L	0.674	0.47
83_R	86_K	0.672	0.46
148_I	202_G	0.672	0.46
98_S	102_Y	0.668	0.46
116_R	225_I	0.665	0.46
152_F	178_L	0.661	0.45
183_V	192_M	0.658	0.45
36_Q	202_G	0.658	0.45
17_G	194_T	0.657	0.45
91_P	122_P	0.654	0.45
140_Y	150_K	0.653	0.45
75_G	82_L	0.649	0.44
61_D	129_Y	0.648	0.44
189_K	193_E	0.647	0.44
27_G	41_D	0.647	0.44
34_P	182_L	0.646	0.44
33_F	77_E	0.646	0.44
77_E	94_E	0.639	0.43
45_I	78_L	0.636	0.43
144_Q	220_T	0.631	0.42
168_G	198_R	0.630	0.42
140_Y	154_V	0.630	0.42
31_W	160_A	0.628	0.42
76_W	146_V	0.628	0.42
65_E	69_D	0.627	0.42
46_Y	54_F	0.625	0.42
45_I	108_T	0.624	0.42
43_R	152_F	0.623	0.42
187_E	197_E	0.622	0.42
43_R	178_L	0.622	0.42
141_L	193_E	0.619	0.41
90_P	136_N	0.615	0.41
196_L	199_K	0.614	0.41
47_V	191_E	0.606	0.40
161_C	188_L	0.605	0.40
118_E	223_E	0.603	0.40
31_W	34_P	0.602	0.40
170_I	175_F	0.602	0.40
23_A	102_Y	0.599	0.39
213_V	220_T	0.599	0.39
30_A	56_I	0.599	0.39
85_F	116_R	0.596	0.39
23_A	129_Y	0.596	0.39
51_E	110_E	0.595	0.39
81_T	92_L	0.592	0.39
76_W	98_S	0.589	0.38
90_P	131_N	0.588	0.38
135_R	205_L	0.588	0.38
158_I	165_E	0.587	0.38
31_W	163_W	0.587	0.38
53_Y	76_W	0.587	0.38
165_E	221_E	0.581	0.38
217_F	220_T	0.577	0.37
180_N	186_P	0.573	0.37
162_Q	194_T	0.573	0.37
195_L	199_K	0.571	0.37
192_M	196_L	0.570	0.37
114_K	117_T	0.570	0.37
17_G	20_I	0.569	0.37
55_S	58_Q	0.569	0.37
112_L	171_P	0.569	0.37
113_R	116_R	0.568	0.36
212_D	221_E	0.566	0.36
186_P	190_A	0.565	0.36
94_E	158_I	0.564	0.36
76_W	95_W	0.562	0.36
36_Q	148_I	0.561	0.36
177_V	181_E	0.555	0.35
105_A	108_T	0.554	0.35
17_G	52_W	0.553	0.35
33_F	182_L	0.553	0.35
94_E	129_Y	0.553	0.35
140_Y	145_E	0.550	0.35
115_L	193_E	0.549	0.35
17_G	145_E	0.548	0.35
57_E	221_E	0.546	0.34
94_E	133_A	0.543	0.34
93_L	125_S	0.543	0.34
103_Y	107_T	0.542	0.34
155_L	172_P	0.540	0.34
31_W	152_F	0.539	0.34
45_I	212_D	0.537	0.34
118_E	187_E	0.536	0.34
116_R	119_A	0.535	0.33
166_K	198_R	0.535	0.33
136_N	141_L	0.535	0.33
201_R	216_Q	0.534	0.33
90_P	151_Y	0.531	0.33
46_Y	61_D	0.526	0.33
19_K	49_K	0.524	0.32
142_Q	147_K	0.523	0.32
28_S	102_Y	0.522	0.32
126_V	171_P	0.522	0.32
79_R	112_L	0.522	0.32
36_Q	131_N	0.520	0.32
57_E	87_K	0.519	0.32
171_P	196_L	0.518	0.32
206_D	212_D	0.518	0.32
96_L	125_S	0.517	0.32
202_G	209_A	0.517	0.32
28_S	149_K	0.517	0.32
139_D	223_E	0.515	0.32
159_L	178_L	0.513	0.32
68_H	143_G	0.510	0.31
170_I	212_D	0.509	0.31
94_E	128_H	0.507	0.31
93_L	131_N	0.506	0.31
114_K	216_Q	0.505	0.31
135_R	140_Y	0.502	0.31
91_P	132_M	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c18A	2	0.9577	97.3	0.891	Contact Map
1knyA	2	0.8615	97.1	0.895	Contact Map
4ebjA	2	0.9115	96	0.907	Contact Map
2rffA	1	0.3692	95.9	0.908	Contact Map
1wotA	1	0.35	95.7	0.909	Contact Map
4cs6A	1	0.85	95.6	0.91	Contact Map
1no5A	4	0.3538	93.9	0.918	Contact Map
2pbeA	1	0.8538	92.2	0.923	Contact Map
3jz0A	2	0.8923	90.2	0.926	Contact Map
1ylqA	2	0.3346	87.9	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.