YXKH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXKH - Putative polysaccharide deacetylase YxkH

UniProt:	P94361	Sequences: MKRLFLSIFLLGSCLALAACADQEANAEQPMPKAEQKKPEKKAVQVQKKEDDTSAWIKTEKPAKLPILMYHSISSGNSLRVPKKEFEAHMKWLHDNGYQTLTPKEASLMLTQDKKPSEKCVLITFDDGYTDNYQDAYPVLKKYGMKATIFMIGKSIGHKHHLTEEQMKEMAQHGISIESHTIDHLELNGLTPQQQQSEMADSKKLFDNMFHQQTTIISYPVGRYNEETLKAAEKTGYQMGVTTEPGAASRDQGMYALHRVRVSPGMSGSAFGAYIESMK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	279 (216)
Sequences:	2193 (1765)
Seq/√Len:	120.1

ECOLI - YADE PGAB
BACSU - YXKH YLXY PDAC YHEN PDAA PDAB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
153_G	182_I	3.140	1.00
140_L	147_A	3.063	1.00
87_E	142_K	3.060	1.00
164_E	209_M	2.978	1.00
191_T	194_Q	2.718	1.00
90_M	139_V	2.553	1.00
73_I	125_F	2.541	1.00
197_S	201_D	2.527	1.00
207_D	213_Q	2.514	1.00
141_K	173_H	2.465	1.00
151_M	167_M	2.435	1.00
183_D	198_E	2.434	1.00
179_S	202_S	2.243	1.00
200_A	204_K	2.150	1.00
91_K	143_Y	2.131	1.00
91_K	95_D	2.127	1.00
192_P	227_E	2.079	1.00
196_Q	234_K	2.072	1.00
137_Y	170_M	2.048	1.00
195_Q	228_T	2.015	1.00
169_E	173_H	2.011	1.00
203_K	207_D	2.002	1.00
70_Y	89_H	1.964	1.00
190_L	194_Q	1.940	1.00
151_M	177_I	1.938	1.00
86_F	90_M	1.886	1.00
100_T	145_M	1.880	1.00
171_A	212_Q	1.878	1.00
122_L	148_T	1.843	1.00
167_M	177_I	1.821	1.00
100_T	146_K	1.776	1.00
150_F	218_S	1.766	1.00
168_K	172_Q	1.758	1.00
92_W	96_N	1.755	1.00
137_Y	173_H	1.749	1.00
132_N	149_I	1.740	1.00
186_E	223_R	1.739	1.00
138_P	169_E	1.730	1.00
203_K	237_Y	1.674	1.00
171_A	210_F	1.660	1.00
130_T	166_Q	1.657	1.00
87_E	143_Y	1.641	1.00
182_I	201_D	1.625	1.00
147_A	175_I	1.625	1.00
217_I	232_A	1.608	1.00
199_M	232_A	1.607	1.00
146_K	175_I	1.597	1.00
168_K	209_M	1.571	1.00
207_D	214_T	1.552	1.00
182_I	198_E	1.521	1.00
133_Y	169_E	1.514	1.00
149_I	175_I	1.494	1.00
185_L	198_E	1.479	1.00
188_N	223_R	1.468	1.00
72_S	131_D	1.462	1.00
67_I	257_L	1.452	1.00
248_A	258_H	1.450	1.00
232_A	235_T	1.441	1.00
217_I	240_G	1.426	1.00
162_L	170_M	1.420	1.00
150_F	241_V	1.418	1.00
205_L	209_M	1.415	1.00
130_T	134_Q	1.410	1.00
139_V	143_Y	1.409	1.00
87_E	91_K	1.401	1.00
69_M	243_T	1.394	1.00
204_K	208_N	1.373	1.00
150_F	216_I	1.368	1.00
133_Y	137_Y	1.363	1.00
165_E	168_K	1.343	1.00
268_G	271_F	1.342	1.00
103_P	122_L	1.329	1.00
125_F	140_L	1.327	1.00
186_E	221_V	1.319	1.00
192_P	230_K	1.306	1.00
230_K	234_K	1.305	1.00
137_Y	141_K	1.303	1.00
181_T	217_I	1.297	1.00
90_M	145_M	1.260	0.99
179_S	203_K	1.248	0.99
154_K	182_I	1.246	0.99
67_I	241_V	1.241	0.99
152_I	181_T	1.234	0.99
231_A	234_K	1.218	0.99
104_K	176_S	1.217	0.99
69_M	261_R	1.217	0.99
85_E	88_A	1.216	0.99
153_G	202_S	1.210	0.99
203_K	214_T	1.196	0.99
117_S	120_C	1.187	0.99
171_A	177_I	1.185	0.99
187_L	228_T	1.184	0.99
137_Y	169_E	1.176	0.99
267_S	270_A	1.165	0.99
182_I	205_L	1.164	0.99
133_Y	166_Q	1.160	0.99
157_G	205_L	1.128	0.99
180_H	184_H	1.122	0.99
170_M	177_I	1.113	0.99
65_L	106_A	1.113	0.99
215_T	238_Q	1.081	0.98
164_E	210_F	1.077	0.98
224_Y	229_L	1.074	0.98
195_Q	199_M	1.072	0.98
106_A	122_L	1.053	0.98
133_Y	170_M	1.051	0.98
149_I	177_I	1.048	0.98
163_T	166_Q	1.047	0.98
186_E	189_G	1.045	0.98
219_Y	232_A	1.040	0.98
192_P	196_Q	1.039	0.98
101_L	106_A	1.032	0.98
102_T	105_E	1.028	0.98
216_I	241_V	1.014	0.98
92_W	271_F	0.996	0.97
219_Y	240_G	0.993	0.97
206_F	214_T	0.992	0.97
246_G	258_H	0.985	0.97
190_L	195_Q	0.979	0.97
216_I	239_M	0.976	0.97
196_Q	231_A	0.973	0.97
65_L	120_C	0.969	0.97
225_N	228_T	0.969	0.97
108_L	112_Q	0.967	0.97
83_K	135_D	0.952	0.96
67_I	70_Y	0.946	0.96
164_E	205_L	0.945	0.96
87_E	139_V	0.939	0.96
179_S	199_M	0.924	0.96
123_I	136_A	0.923	0.96
90_M	143_Y	0.916	0.96
104_K	108_L	0.915	0.96
94_H	143_Y	0.912	0.95
136_A	139_V	0.910	0.95
125_F	136_A	0.910	0.95
97_G	119_K	0.897	0.95
253_G	256_A	0.897	0.95
148_T	176_S	0.895	0.95
177_I	210_F	0.888	0.95
137_Y	175_I	0.887	0.95
162_L	167_M	0.884	0.95
167_M	210_F	0.882	0.95
181_T	185_L	0.877	0.94
105_E	108_L	0.875	0.94
156_I	209_M	0.870	0.94
231_A	235_T	0.857	0.94
122_L	241_V	0.855	0.94
89_H	271_F	0.845	0.93
170_M	174_G	0.842	0.93
151_M	170_M	0.841	0.93
242_T	246_G	0.838	0.93
107_S	239_M	0.838	0.93
196_Q	200_A	0.834	0.93
75_S	135_D	0.833	0.93
90_M	100_T	0.827	0.93
116_P	120_C	0.815	0.92
201_D	204_K	0.809	0.92
124_T	128_G	0.806	0.92
70_Y	86_F	0.805	0.91
93_L	98_Y	0.803	0.91
82_P	85_E	0.799	0.91
65_L	101_L	0.799	0.91
85_E	89_H	0.796	0.91
190_L	198_E	0.793	0.91
196_Q	235_T	0.793	0.91
195_Q	231_A	0.789	0.91
73_I	86_F	0.786	0.90
77_N	80_R	0.785	0.90
90_M	121_V	0.780	0.90
68_L	71_H	0.779	0.90
104_K	216_I	0.770	0.90
184_H	198_E	0.770	0.90
139_V	145_M	0.760	0.89
266_M	270_A	0.760	0.89
128_G	132_N	0.754	0.89
133_Y	138_P	0.748	0.88
227_E	230_K	0.746	0.88
91_K	94_H	0.746	0.88
193_Q	197_S	0.740	0.88
149_I	162_L	0.740	0.88
218_S	241_V	0.738	0.88
193_Q	196_Q	0.723	0.86
73_I	81_V	0.718	0.86
92_W	268_G	0.718	0.86
240_G	255_Y	0.712	0.86
150_F	178_E	0.706	0.85
57_I	60_E	0.702	0.85
264_P	267_S	0.697	0.84
209_M	212_Q	0.696	0.84
71_H	127_D	0.695	0.84
125_F	128_G	0.695	0.84
79_L	261_R	0.694	0.84
105_E	146_K	0.693	0.84
176_S	216_I	0.691	0.84
222_G	242_T	0.689	0.84
198_E	201_D	0.688	0.84
262_V	271_F	0.687	0.84
71_H	259_R	0.686	0.83
72_S	80_R	0.681	0.83
243_T	261_R	0.681	0.83
199_M	217_I	0.681	0.83
84_K	88_A	0.678	0.83
135_D	139_V	0.671	0.82
156_I	164_E	0.669	0.82
87_E	90_M	0.660	0.81
68_L	86_F	0.657	0.81
156_I	160_H	0.655	0.81
229_L	256_A	0.654	0.80
188_N	228_T	0.652	0.80
127_D	221_V	0.651	0.80
99_Q	105_E	0.650	0.80
195_Q	227_E	0.649	0.80
154_K	183_D	0.649	0.80
70_Y	73_I	0.648	0.80
73_I	131_D	0.646	0.80
132_N	147_A	0.645	0.80
156_I	167_M	0.643	0.79
192_P	195_Q	0.642	0.79
123_I	145_M	0.642	0.79
66_P	72_S	0.640	0.79
63_A	66_P	0.635	0.78
226_E	230_K	0.635	0.78
205_L	208_N	0.634	0.78
194_Q	197_S	0.624	0.77
197_S	200_A	0.624	0.77
103_P	216_I	0.623	0.77
93_L	121_V	0.621	0.77
195_Q	198_E	0.619	0.77
242_T	245_P	0.619	0.77
89_H	262_V	0.616	0.76
233_E	255_Y	0.616	0.76
154_K	181_T	0.614	0.76
127_D	180_H	0.613	0.76
134_Q	166_Q	0.612	0.76
194_Q	198_E	0.612	0.76
219_Y	243_T	0.612	0.76
109_M	116_P	0.612	0.76
128_G	151_M	0.610	0.76
218_S	243_T	0.608	0.75
197_S	204_K	0.607	0.75
248_A	257_L	0.607	0.75
78_S	81_V	0.606	0.75
98_Y	119_K	0.600	0.74
228_T	231_A	0.598	0.74
86_F	89_H	0.598	0.74
67_I	106_A	0.598	0.74
195_Q	225_N	0.598	0.74
252_Q	260_V	0.597	0.74
170_M	175_I	0.594	0.74
185_L	190_L	0.593	0.74
90_M	94_H	0.592	0.73
90_M	93_L	0.591	0.73
166_Q	169_E	0.590	0.73
187_L	190_L	0.589	0.73
230_K	233_E	0.588	0.73
78_S	261_R	0.586	0.73
111_T	238_Q	0.585	0.73
239_M	254_M	0.585	0.73
157_G	164_E	0.584	0.72
74_S	83_K	0.582	0.72
71_H	93_L	0.581	0.72
81_V	262_V	0.579	0.72
232_A	237_Y	0.572	0.71
229_L	233_E	0.570	0.71
206_F	210_F	0.570	0.71
66_P	146_K	0.567	0.70
157_G	160_H	0.567	0.70
224_Y	244_E	0.566	0.70
101_L	105_E	0.564	0.70
141_K	169_E	0.563	0.70
86_F	136_A	0.563	0.70
161_H	178_E	0.560	0.69
104_K	215_T	0.558	0.69
125_F	149_I	0.557	0.69
99_Q	120_C	0.555	0.69
100_T	120_C	0.554	0.69
93_L	97_G	0.552	0.68
99_Q	117_S	0.549	0.68
252_Q	258_H	0.547	0.68
168_K	211_H	0.546	0.67
125_F	147_A	0.545	0.67
101_L	120_C	0.544	0.67
94_H	144_G	0.543	0.67
187_L	191_T	0.543	0.67
134_Q	138_P	0.540	0.67
150_F	239_M	0.539	0.66
73_I	89_H	0.539	0.66
249_S	252_Q	0.539	0.66
102_T	106_A	0.538	0.66
224_Y	228_T	0.538	0.66
174_G	211_H	0.537	0.66
93_L	259_R	0.537	0.66
178_E	271_F	0.535	0.66
122_L	140_L	0.535	0.66
199_M	235_T	0.535	0.66
70_Y	90_M	0.530	0.65
228_T	236_G	0.527	0.65
123_I	147_A	0.525	0.64
81_V	85_E	0.525	0.64
93_L	96_N	0.525	0.64
82_P	224_Y	0.524	0.64
200_A	235_T	0.523	0.64
90_M	147_A	0.520	0.64
187_L	221_V	0.520	0.64
252_Q	257_L	0.520	0.64
149_I	242_T	0.519	0.64
86_F	93_L	0.518	0.63
71_H	86_F	0.516	0.63
251_D	254_M	0.515	0.63
187_L	194_Q	0.515	0.63
56_W	59_T	0.514	0.63
133_Y	218_S	0.512	0.62
187_L	198_E	0.512	0.62
95_D	172_Q	0.512	0.62
68_L	121_V	0.512	0.62
72_S	79_L	0.506	0.62
88_A	142_K	0.506	0.62
148_T	178_E	0.505	0.61
182_I	197_S	0.504	0.61
206_F	209_M	0.503	0.61
137_Y	177_I	0.503	0.61
81_V	89_H	0.502	0.61
152_I	221_V	0.501	0.61
245_P	261_R	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4v33A	1	0.7885	100	0.242	Contact Map
3vusA	1	0.7921	100	0.267	Contact Map
4f9dA	1	0.7885	100	0.269	Contact Map
4u10A	1	0.7634	100	0.27	Contact Map
5bu6A	2	0.7563	100	0.273	Contact Map
4wcjA	1	0.7814	100	0.276	Contact Map
4l1gA	1	0.6308	100	0.317	Contact Map
2w3zA	1	0.681	100	0.393	Contact Map
2c1iA	1	0.8674	100	0.422	Contact Map
4m1bA	1	0.5986	100	0.455	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.