YXJI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXJI - Uncharacterized protein YxjI

UniProt:	P94352	Sequences: MIELFMKQKMFSFKDAFHIYDRDEQETFKVEGRFFSLGDSLQMTDSSGKTLVSIEQKLMSLLPRYEISIGGKTVCEVTKKVTFSKPKFVISGLNWEIDGDLWRDEFQLTDGENVRMSVSKKWLSWGDSYHLQIAYEEDVLICTAIAIVLDMVLYNDEDESIF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (153)
Sequences:	1027 (736)
Seq/√Len:	59.5

BACSU - YXJI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_D	25_Q	5.462	1.00
57_K	66_E	4.514	1.00
116_M	142_C	4.005	1.00
131_L	142_C	3.835	1.00
45_D	49_K	3.267	1.00
10_M	126_G	2.735	1.00
67_I	75_C	2.630	1.00
52_V	144_A	2.625	1.00
80_K	89_V	2.619	1.00
42_Q	50_T	2.362	1.00
114_V	117_S	2.224	1.00
31_E	44_T	2.161	1.00
4_L	27_T	2.151	1.00
17_F	150_D	2.095	1.00
107_Q	117_S	2.052	1.00
110_D	113_N	1.962	1.00
86_P	90_I	1.954	1.00
19_I	126_G	1.933	1.00
3_E	22_R	1.920	1.00
60_S	64_R	1.830	1.00
16_A	31_E	1.750	0.99
64_R	78_T	1.679	0.99
117_S	132_Q	1.594	0.99
15_D	120_K	1.513	0.98
107_Q	114_V	1.506	0.98
54_I	67_I	1.487	0.98
14_K	32_G	1.479	0.98
20_Y	26_E	1.476	0.98
8_Q	149_L	1.451	0.98
55_E	68_S	1.418	0.97
3_E	132_Q	1.415	0.97
108_L	116_M	1.398	0.97
105_E	119_S	1.389	0.97
36_S	40_S	1.381	0.97
137_E	142_C	1.367	0.96
77_V	148_V	1.351	0.96
121_K	124_S	1.335	0.96
69_I	72_K	1.313	0.96
57_K	60_S	1.282	0.95
20_Y	131_L	1.255	0.94
6_M	131_L	1.247	0.94
135_Y	138_D	1.231	0.94
29_K	48_G	1.220	0.93
5_F	128_S	1.215	0.93
19_I	30_V	1.213	0.93
10_M	125_W	1.212	0.93
40_S	65_Y	1.189	0.93
41_L	147_I	1.183	0.92
99_G	129_Y	1.182	0.92
106_F	127_D	1.162	0.92
108_L	142_C	1.155	0.91
62_L	78_T	1.148	0.91
57_K	109_T	1.129	0.90
118_V	150_D	1.095	0.89
57_K	64_R	1.088	0.89
151_M	155_N	1.085	0.89
4_L	51_L	1.076	0.88
8_Q	150_D	1.073	0.88
97_I	108_L	1.072	0.88
114_V	134_A	1.061	0.88
115_R	137_E	1.049	0.87
40_S	55_E	1.043	0.87
32_G	41_L	1.043	0.87
131_L	143_T	1.041	0.86
17_F	149_L	1.038	0.86
16_A	33_R	1.030	0.86
136_E	139_V	1.026	0.86
77_V	107_Q	1.020	0.85
18_H	26_E	1.013	0.85
12_S	55_E	1.004	0.84
44_T	48_G	1.003	0.84
8_Q	148_V	0.986	0.83
127_D	146_A	0.982	0.83
95_W	115_R	0.970	0.82
28_F	139_V	0.969	0.82
109_T	114_V	0.964	0.82
41_L	151_M	0.961	0.82
17_F	118_V	0.954	0.81
6_M	10_M	0.953	0.81
141_I	145_I	0.951	0.81
115_R	136_E	0.949	0.81
5_F	19_I	0.949	0.81
33_R	42_Q	0.938	0.80
4_L	131_L	0.934	0.80
61_L	72_K	0.934	0.80
5_F	10_M	0.934	0.80
7_K	128_S	0.927	0.79
30_V	147_I	0.919	0.79
62_L	81_V	0.914	0.78
121_K	127_D	0.914	0.78
115_R	150_D	0.911	0.78
6_M	120_K	0.902	0.77
99_G	150_D	0.900	0.77
9_K	12_S	0.900	0.77
29_K	117_S	0.891	0.77
42_Q	53_S	0.883	0.76
84_S	90_I	0.881	0.76
69_I	138_D	0.880	0.76
129_Y	146_A	0.867	0.75
38_G	56_Q	0.865	0.74
7_K	126_G	0.863	0.74
35_F	56_Q	0.861	0.74
87_K	96_E	0.859	0.74
28_F	39_D	0.854	0.73
53_S	73_T	0.852	0.73
116_M	131_L	0.851	0.73
59_M	66_E	0.847	0.73
13_F	20_Y	0.843	0.73
31_E	117_S	0.842	0.72
121_K	130_H	0.840	0.72
104_D	122_W	0.836	0.72
39_D	154_Y	0.833	0.72
116_M	152_V	0.830	0.71
19_I	80_K	0.829	0.71
47_S	89_V	0.829	0.71
100_D	148_V	0.829	0.71
72_K	141_I	0.818	0.70
6_M	142_C	0.816	0.70
77_V	97_I	0.816	0.70
40_S	92_G	0.812	0.70
63_P	144_A	0.805	0.69
79_K	85_K	0.796	0.68
78_T	109_T	0.794	0.68
131_L	134_A	0.791	0.68
68_S	95_W	0.788	0.67
97_I	137_E	0.775	0.66
137_E	143_T	0.773	0.66
47_S	116_M	0.772	0.66
84_S	100_D	0.771	0.66
61_L	87_K	0.771	0.66
37_L	58_L	0.770	0.66
71_G	81_V	0.770	0.66
91_S	100_D	0.761	0.65
99_G	147_I	0.756	0.64
14_K	34_F	0.755	0.64
95_W	106_F	0.753	0.64
104_D	153_L	0.753	0.64
64_R	76_E	0.740	0.62
33_R	44_T	0.734	0.62
27_T	98_D	0.729	0.61
102_W	123_L	0.725	0.61
10_M	29_K	0.724	0.61
7_K	10_M	0.720	0.60
61_L	83_F	0.718	0.60
13_F	147_I	0.713	0.60
28_F	68_S	0.707	0.59
18_H	43_M	0.702	0.58
10_M	19_I	0.695	0.58
93_L	136_E	0.693	0.57
5_F	130_H	0.691	0.57
56_Q	60_S	0.691	0.57
92_G	108_L	0.690	0.57
79_K	82_T	0.683	0.56
63_P	79_K	0.682	0.56
56_Q	106_F	0.682	0.56
4_L	19_I	0.675	0.55
144_A	151_M	0.667	0.55
98_D	142_C	0.666	0.54
122_W	148_V	0.662	0.54
33_R	125_W	0.654	0.53
47_S	133_I	0.654	0.53
65_Y	148_V	0.653	0.53
54_I	66_E	0.653	0.53
18_H	44_T	0.653	0.53
8_Q	129_Y	0.648	0.52
15_D	30_V	0.642	0.52
11_F	127_D	0.632	0.51
97_I	145_I	0.627	0.50
59_M	147_I	0.620	0.49
151_M	154_Y	0.618	0.49
95_W	151_M	0.617	0.49
75_C	104_D	0.616	0.49
65_Y	153_L	0.616	0.49
91_S	114_V	0.608	0.48
38_G	105_E	0.608	0.48
78_T	87_K	0.601	0.47
133_I	139_V	0.601	0.47
43_M	143_T	0.597	0.47
32_G	35_F	0.597	0.47
49_K	98_D	0.597	0.47
35_F	59_M	0.587	0.46
17_F	99_G	0.586	0.46
6_M	19_I	0.584	0.45
121_K	143_T	0.583	0.45
15_D	33_R	0.576	0.44
52_V	148_V	0.574	0.44
96_E	130_H	0.573	0.44
109_T	112_E	0.573	0.44
7_K	32_G	0.570	0.44
60_S	81_V	0.570	0.44
62_L	80_K	0.569	0.44
81_V	91_S	0.568	0.44
129_Y	150_D	0.565	0.43
49_K	111_G	0.563	0.43
25_Q	49_K	0.563	0.43
27_T	139_V	0.563	0.43
69_I	73_T	0.562	0.43
12_S	128_S	0.559	0.43
24_E	131_L	0.555	0.42
25_Q	70_G	0.554	0.42
72_K	140_L	0.554	0.42
100_D	103_R	0.551	0.42
12_S	37_L	0.551	0.42
74_V	147_I	0.547	0.41
26_E	116_M	0.546	0.41
75_C	93_L	0.545	0.41
14_K	136_E	0.544	0.41
7_K	28_F	0.542	0.41
22_R	63_P	0.540	0.40
9_K	13_F	0.537	0.40
8_Q	12_S	0.536	0.40
21_D	141_I	0.535	0.40
54_I	77_V	0.534	0.40
29_K	66_E	0.530	0.39
110_D	115_R	0.525	0.39
26_E	65_Y	0.524	0.39
43_M	70_G	0.523	0.39
65_Y	75_C	0.523	0.39
89_V	110_D	0.522	0.39
28_F	33_R	0.521	0.38
4_L	101_L	0.513	0.38
54_I	123_L	0.512	0.38
97_I	111_G	0.508	0.37
40_S	68_S	0.507	0.37
10_M	20_Y	0.507	0.37
14_K	118_V	0.505	0.37
75_C	130_H	0.505	0.37
5_F	11_F	0.504	0.37
106_F	120_K	0.503	0.37
54_I	130_H	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zxuA	1	0.8272	100	0.343	Contact Map
3lhnA	4	0.3642	16.4	0.943	Contact Map
1ufgA	1	0.3889	14.5	0.944	Contact Map
4u3qA	1	0.284	9.1	0.949	Contact Map
2v2fA	1	0.0926	8.4	0.95	Contact Map
3umnA	1	0.3642	7.1	0.951	Contact Map
3my2A	2	0.7099	6.9	0.952	Contact Map
4kc5A	2	0.3272	6.9	0.952	Contact Map
2vnlA	3	0.5926	5.8	0.953	Contact Map
1ifrA	1	0.3457	5.3	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.