G16U - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

G16U - General stress protein 16U

UniProt:	P80875	Sequences: MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSSVFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANIDKISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYRHNGEWKFSAIGSGYQGGLARIATDYGLQVG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	193 (176)
Sequences:	3028 (1613)
Seq/√Len:	121.6

BACSU - G16U YCEE SCP2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_V	106_I	4.875	1.00
159_G	170_F	3.727	1.00
56_A	60_D	3.365	1.00
51_A	104_D	3.363	1.00
95_N	98_A	3.309	1.00
140_E	143_R	3.191	1.00
179_G	183_R	3.093	1.00
68_E	75_V	2.775	1.00
10_K	171_S	2.681	1.00
162_Y	169_K	2.666	1.00
182_A	186_T	2.646	1.00
48_L	74_V	2.622	1.00
177_Y	187_D	2.607	1.00
48_L	103_I	2.508	1.00
28_G	129_F	2.438	1.00
105_K	160_E	2.377	1.00
60_D	70_G	2.196	1.00
30_D	127_N	2.096	1.00
77_S	93_K	2.093	1.00
130_V	159_G	2.035	1.00
22_K	95_N	1.968	1.00
164_H	169_K	1.947	1.00
134_N	137_T	1.918	1.00
131_R	140_E	1.913	1.00
21_S	97_S	1.909	1.00
24_V	91_N	1.898	1.00
99_V	106_I	1.752	1.00
12_D	15_K	1.750	1.00
3_I	11_V	1.739	1.00
77_S	91_N	1.735	1.00
71_N	100_P	1.731	1.00
109_V	184_I	1.661	1.00
10_K	169_K	1.613	1.00
134_N	139_E	1.608	1.00
46_V	92_V	1.585	1.00
64_Y	113_H	1.582	1.00
144_Y	174_G	1.505	1.00
26_G	88_D	1.487	1.00
49_L	107_S	1.437	1.00
160_E	171_S	1.413	1.00
107_S	160_E	1.386	1.00
75_V	93_K	1.382	1.00
94_V	108_F	1.347	1.00
88_D	131_R	1.338	1.00
94_V	161_L	1.336	1.00
45_S	109_V	1.327	1.00
6_A	9_Q	1.324	1.00
46_V	108_F	1.315	1.00
41_D	90_E	1.304	1.00
48_L	60_D	1.292	1.00
45_S	111_T	1.291	1.00
62_I	69_G	1.277	1.00
152_I	178_Q	1.256	0.99
24_V	135_E	1.249	0.99
48_L	99_V	1.243	0.99
47_F	55_C	1.240	0.99
56_A	102_N	1.231	0.99
162_Y	171_S	1.224	0.99
130_V	170_F	1.191	0.99
69_G	73_S	1.181	0.99
108_F	161_L	1.178	0.99
22_K	97_S	1.177	0.99
41_D	79_D	1.173	0.99
20_L	23_V	1.158	0.99
80_N	89_D	1.148	0.99
73_S	99_V	1.140	0.99
53_G	105_K	1.117	0.99
25_V	108_F	1.115	0.99
42_L	125_V	1.112	0.99
155_A	177_Y	1.109	0.99
129_F	143_R	1.077	0.98
24_V	133_V	1.074	0.98
26_G	131_R	1.074	0.98
183_R	186_T	1.045	0.98
57_S	60_D	1.039	0.98
65_N	113_H	1.036	0.98
79_D	90_E	1.026	0.98
25_V	132_I	1.012	0.98
24_V	93_K	1.011	0.98
78_G	90_E	0.993	0.97
183_R	187_D	0.987	0.97
157_I	184_I	0.984	0.97
56_A	103_I	0.969	0.97
153_E	177_Y	0.964	0.97
43_D	64_Y	0.952	0.97
144_Y	172_A	0.949	0.97
135_E	138_N	0.949	0.97
22_K	93_K	0.948	0.97
164_H	167_E	0.938	0.96
157_I	160_E	0.935	0.96
76_H	90_E	0.931	0.96
181_L	185_A	0.929	0.96
53_G	104_D	0.926	0.96
10_K	162_Y	0.922	0.96
93_K	135_E	0.910	0.96
104_D	166_G	0.906	0.95
161_L	170_F	0.905	0.95
180_G	183_R	0.902	0.95
99_V	163_R	0.901	0.95
41_D	76_H	0.893	0.95
45_S	64_Y	0.893	0.95
80_N	85_G	0.881	0.95
48_L	56_A	0.880	0.95
79_D	83_G	0.872	0.94
49_L	105_K	0.871	0.94
99_V	103_I	0.871	0.94
60_D	69_G	0.870	0.94
32_N	36_G	0.862	0.94
11_V	142_I	0.862	0.94
133_V	140_E	0.859	0.94
58_P	61_F	0.855	0.94
60_D	71_N	0.855	0.94
48_L	106_I	0.848	0.94
14_T	167_E	0.845	0.93
111_T	177_Y	0.845	0.93
40_F	125_V	0.843	0.93
29_W	90_E	0.841	0.93
50_D	104_D	0.838	0.93
79_D	89_D	0.837	0.93
22_K	135_E	0.829	0.93
110_I	158_A	0.824	0.93
48_L	69_G	0.808	0.92
31_T	84_A	0.808	0.92
165_N	169_K	0.806	0.92
83_G	90_E	0.803	0.92
121_N	124_Q	0.800	0.91
118_R	122_F	0.795	0.91
160_E	173_I	0.786	0.91
29_W	41_D	0.780	0.90
9_Q	152_I	0.778	0.90
47_F	111_T	0.772	0.90
66_Q	69_G	0.767	0.90
15_K	20_L	0.751	0.89
122_F	125_V	0.746	0.88
49_L	160_E	0.742	0.88
27_L	44_S	0.739	0.88
121_N	152_I	0.738	0.88
90_E	110_I	0.737	0.88
111_T	183_R	0.733	0.87
47_F	187_D	0.732	0.87
48_L	73_S	0.726	0.87
81_L	118_R	0.725	0.87
8_G	169_K	0.720	0.87
12_D	167_E	0.720	0.87
50_D	103_I	0.718	0.86
23_V	96_L	0.717	0.86
50_D	56_A	0.717	0.86
104_D	163_R	0.714	0.86
118_R	123_G	0.711	0.86
28_G	131_R	0.711	0.86
50_D	102_N	0.709	0.86
23_V	161_L	0.705	0.85
47_F	58_P	0.704	0.85
21_S	95_N	0.696	0.85
9_Q	171_S	0.694	0.85
8_G	176_G	0.692	0.84
41_D	89_D	0.690	0.84
25_V	170_F	0.688	0.84
155_A	181_L	0.687	0.84
64_Y	111_T	0.686	0.84
37_G	64_Y	0.679	0.83
153_E	175_S	0.679	0.83
155_A	188_Y	0.677	0.83
163_R	168_W	0.675	0.83
10_K	164_H	0.671	0.82
82_T	85_G	0.670	0.82
67_L	76_H	0.668	0.82
88_D	129_F	0.667	0.82
150_F	156_I	0.657	0.81
55_C	58_P	0.655	0.81
68_E	98_A	0.654	0.81
30_D	126_S	0.649	0.80
119_S	122_F	0.649	0.80
66_Q	113_H	0.647	0.80
55_C	60_D	0.646	0.80
61_F	66_Q	0.644	0.80
150_F	153_E	0.635	0.79
47_F	63_F	0.633	0.79
26_G	89_D	0.632	0.79
55_C	185_A	0.631	0.78
153_E	176_G	0.630	0.78
58_P	63_F	0.625	0.78
157_I	177_Y	0.623	0.78
181_L	188_Y	0.623	0.78
134_N	141_L	0.622	0.77
105_K	157_I	0.621	0.77
82_T	86_E	0.620	0.77
120_Q	124_Q	0.620	0.77
4_S	11_V	0.619	0.77
44_S	76_H	0.616	0.77
39_D	81_L	0.614	0.77
107_S	157_I	0.612	0.76
25_V	94_V	0.611	0.76
31_T	126_S	0.610	0.76
96_L	163_R	0.608	0.76
28_G	88_D	0.606	0.76
108_F	130_V	0.603	0.75
45_S	76_H	0.603	0.75
7_K	15_K	0.593	0.74
146_L	158_A	0.592	0.74
132_I	159_G	0.591	0.74
13_L	73_S	0.588	0.73
38_H	124_Q	0.583	0.73
99_V	168_W	0.580	0.72
118_R	124_Q	0.580	0.72
109_V	185_A	0.576	0.72
129_F	133_V	0.575	0.72
132_I	179_G	0.573	0.72
44_S	110_I	0.573	0.72
30_D	84_A	0.573	0.72
90_E	112_I	0.572	0.71
43_D	79_D	0.571	0.71
10_K	175_S	0.567	0.71
58_P	70_G	0.567	0.71
30_D	82_T	0.566	0.71
183_R	189_G	0.566	0.71
177_Y	184_I	0.565	0.71
129_F	145_D	0.565	0.71
5_L	90_E	0.563	0.70
49_L	54_K	0.563	0.70
4_S	12_D	0.562	0.70
128_A	146_L	0.561	0.70
48_L	71_N	0.560	0.70
62_I	74_V	0.559	0.70
107_S	188_Y	0.555	0.69
3_I	12_D	0.551	0.69
134_N	138_N	0.549	0.68
83_G	89_D	0.548	0.68
32_N	40_F	0.546	0.68
32_N	150_F	0.545	0.68
175_S	178_Q	0.544	0.68
105_K	162_Y	0.543	0.67
7_K	144_Y	0.542	0.67
88_D	140_E	0.540	0.67
31_T	40_F	0.538	0.67
69_G	132_I	0.538	0.67
3_I	6_A	0.538	0.67
76_H	92_V	0.537	0.67
25_V	158_A	0.537	0.67
123_G	152_I	0.535	0.66
8_G	162_Y	0.535	0.66
153_E	180_G	0.534	0.66
48_L	70_G	0.533	0.66
71_N	98_A	0.529	0.66
66_Q	70_G	0.528	0.65
120_Q	125_V	0.527	0.65
8_G	172_A	0.527	0.65
41_D	83_G	0.523	0.65
157_I	187_D	0.522	0.64
32_N	126_S	0.521	0.64
55_C	61_F	0.519	0.64
122_F	172_A	0.519	0.64
112_I	120_Q	0.519	0.64
56_A	70_G	0.515	0.63
61_F	181_L	0.514	0.63
78_G	85_G	0.514	0.63
26_G	133_V	0.512	0.63
6_A	135_E	0.511	0.63
171_S	175_S	0.510	0.63
65_N	111_T	0.510	0.63
47_F	150_F	0.505	0.62
80_N	83_G	0.503	0.62
20_L	102_N	0.501	0.61
128_A	151_S	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ibzA	1	0.9171	100	-0.007	Contact Map
2kxtA	1	0.9016	100	-0.002	Contact Map
2qngA	1	0.8653	100	0.076	Contact Map
2qz7A	1	0.8601	100	0.086	Contact Map
2rn7A	1	0.1865	6.9	0.954	Contact Map
2i0fA	3	0.4611	6.8	0.954	Contact Map
3fcsB	1	0.7409	6.2	0.955	Contact Map
2o2pA	5	0.4819	6	0.955	Contact Map
1e0tA	3	0.8549	4.6	0.957	Contact Map
2e28A	3	0.8653	3.9	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.