G16O - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

G16O - General stress protein 16O

UniProt:	P80872	Sequences: MALTKEQTQHLYHKLLDMQKELSGEKKETESMTEEVGELSNGVDNHMADHGTLVTDRMTDQTVKEIDRELLEEVNRALQKMKDGTYGVCEKTGQEIPYERLEAVPYARMTVEAQADVEDDLETDAPSYEREFHEQVKDLSNKETIDQKSSQTYEILDREQDSK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (156)
Sequences:	388 (321)
Seq/√Len:	25.7

ECOLI - DKSA
BACSU - G16O YTEA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
147_Q	155_I	5.720	1.00
92_T	110_T	5.354	1.00
90_E	108_R	3.683	1.00
56_D	59_T	3.315	1.00
92_T	113_A	3.209	1.00
12_Y	82_K	2.901	1.00
11_L	81_M	2.739	0.99
18_M	70_L	2.601	0.99
150_S	154_E	2.551	0.99
22_L	74_V	2.510	0.99
19_Q	23_S	2.283	0.98
4_T	7_Q	2.277	0.98
110_T	113_A	2.217	0.97
11_L	98_Y	2.156	0.97
25_E	67_D	2.011	0.95
125_A	129_E	1.994	0.95
57_R	60_D	1.967	0.95
23_S	75_N	1.930	0.94
151_Q	154_E	1.900	0.94
152_T	156_L	1.833	0.93
88_V	95_E	1.825	0.92
32_M	36_V	1.775	0.91
55_T	58_M	1.693	0.89
10_H	102_E	1.661	0.88
79_Q	83_D	1.646	0.88
157_D	161_D	1.488	0.82
33_T	43_V	1.482	0.82
8_T	81_M	1.466	0.81
104_V	107_A	1.463	0.81
138_D	149_S	1.459	0.80
125_A	128_Y	1.457	0.80
54_V	62_T	1.444	0.80
153_Y	161_D	1.438	0.79
70_L	106_Y	1.369	0.76
18_M	21_E	1.364	0.76
56_D	60_D	1.358	0.75
147_Q	153_Y	1.357	0.75
19_Q	71_L	1.352	0.75
51_G	55_T	1.319	0.73
59_T	63_V	1.275	0.71
139_L	144_T	1.272	0.70
94_Q	112_E	1.271	0.70
3_L	7_Q	1.268	0.70
109_M	115_A	1.243	0.69
76_R	80_K	1.237	0.68
80_K	108_R	1.220	0.67
139_L	149_S	1.215	0.67
33_T	41_N	1.212	0.67
12_Y	81_M	1.210	0.66
54_V	58_M	1.209	0.66
152_T	157_D	1.205	0.66
7_Q	98_Y	1.202	0.66
130_R	133_H	1.180	0.64
14_K	18_M	1.165	0.63
155_I	158_R	1.165	0.63
22_L	25_E	1.157	0.63
149_S	153_Y	1.150	0.62
35_E	56_D	1.137	0.62
76_R	108_R	1.134	0.61
19_Q	75_N	1.132	0.61
56_D	103_A	1.124	0.61
51_G	58_M	1.114	0.60
91_K	113_A	1.110	0.60
145_I	150_S	1.098	0.59
148_K	154_E	1.092	0.58
77_A	80_K	1.088	0.58
155_I	159_E	1.079	0.57
143_E	146_D	1.042	0.55
147_Q	159_E	1.041	0.55
76_R	90_E	1.036	0.54
149_S	154_E	1.029	0.54
114_Q	117_V	1.005	0.52
62_T	92_T	0.998	0.52
39_L	44_D	0.995	0.51
6_E	10_H	0.993	0.51
3_L	37_G	0.993	0.51
138_D	153_Y	0.984	0.50
39_L	45_N	0.984	0.50
69_E	73_E	0.983	0.50
136_V	150_S	0.976	0.50
73_E	108_R	0.974	0.50
53_L	56_D	0.973	0.50
9_Q	12_Y	0.951	0.48
145_I	149_S	0.935	0.47
20_K	82_K	0.930	0.47
89_C	92_T	0.929	0.46
31_S	109_M	0.917	0.46
47_M	126_P	0.910	0.45
107_A	153_Y	0.910	0.45
138_D	147_Q	0.908	0.45
31_S	111_V	0.902	0.44
41_N	50_H	0.901	0.44
29_T	113_A	0.888	0.43
71_L	152_T	0.886	0.43
41_N	81_M	0.882	0.43
126_P	129_E	0.878	0.43
47_M	128_Y	0.869	0.42
39_L	47_M	0.863	0.42
40_S	45_N	0.861	0.42
147_Q	150_S	0.861	0.42
131_E	146_D	0.860	0.41
145_I	154_E	0.858	0.41
75_N	95_E	0.849	0.41
149_S	157_D	0.817	0.38
9_Q	13_H	0.816	0.38
4_T	98_Y	0.813	0.38
40_S	46_H	0.799	0.37
80_K	146_D	0.797	0.37
93_G	107_A	0.786	0.36
140_S	149_S	0.785	0.36
89_C	110_T	0.785	0.36
41_N	107_A	0.780	0.36
114_Q	157_D	0.779	0.36
37_G	57_R	0.773	0.35
12_Y	34_E	0.773	0.35
148_K	151_Q	0.770	0.35
8_T	74_V	0.768	0.35
153_Y	160_Q	0.767	0.35
13_H	16_L	0.766	0.35
10_H	14_K	0.763	0.35
107_A	114_Q	0.761	0.35
50_H	53_L	0.760	0.35
33_T	50_H	0.760	0.35
59_T	103_A	0.754	0.34
59_T	154_E	0.742	0.33
114_Q	118_E	0.740	0.33
31_S	36_V	0.738	0.33
59_T	62_T	0.738	0.33
39_L	46_H	0.736	0.33
48_A	51_G	0.732	0.33
12_Y	16_L	0.730	0.33
48_A	103_A	0.728	0.32
17_D	21_E	0.726	0.32
131_E	144_T	0.723	0.32
3_L	57_R	0.723	0.32
90_E	109_M	0.722	0.32
15_L	38_E	0.714	0.32
47_M	125_A	0.714	0.32
3_L	98_Y	0.709	0.31
5_K	83_D	0.707	0.31
44_D	47_M	0.702	0.31
10_H	83_D	0.700	0.31
14_K	79_Q	0.700	0.31
156_L	159_E	0.693	0.30
47_M	52_T	0.691	0.30
136_V	146_D	0.690	0.30
30_E	34_E	0.690	0.30
20_K	23_S	0.689	0.30
35_E	93_G	0.688	0.30
65_E	85_T	0.680	0.29
29_T	114_Q	0.678	0.29
26_K	29_T	0.675	0.29
139_L	147_Q	0.675	0.29
131_E	138_D	0.661	0.28
142_K	157_D	0.658	0.28
113_A	160_Q	0.654	0.28
136_V	149_S	0.652	0.28
136_V	140_S	0.651	0.28
3_L	122_E	0.650	0.28
3_L	18_M	0.643	0.27
111_V	114_Q	0.640	0.27
35_E	60_D	0.637	0.27
20_K	143_E	0.631	0.27
97_P	109_M	0.628	0.26
36_V	50_H	0.627	0.26
140_S	150_S	0.624	0.26
116_D	143_E	0.622	0.26
92_T	151_Q	0.621	0.26
54_V	153_Y	0.621	0.26
107_A	135_Q	0.620	0.26
18_M	102_E	0.618	0.26
4_T	13_H	0.616	0.26
51_G	63_V	0.616	0.26
23_S	74_V	0.612	0.25
111_V	121_L	0.612	0.25
153_Y	159_E	0.610	0.25
93_G	101_L	0.609	0.25
66_I	121_L	0.602	0.25
40_S	44_D	0.602	0.25
138_D	144_T	0.601	0.25
50_H	155_I	0.601	0.25
9_Q	127_S	0.600	0.25
145_I	153_Y	0.597	0.25
152_T	161_D	0.594	0.24
110_T	151_Q	0.590	0.24
81_M	95_E	0.590	0.24
103_A	118_E	0.589	0.24
74_V	156_L	0.586	0.24
9_Q	111_V	0.586	0.24
100_R	105_P	0.583	0.24
47_M	129_E	0.583	0.24
113_A	161_D	0.582	0.24
55_T	149_S	0.581	0.24
16_L	20_K	0.579	0.24
73_E	161_D	0.576	0.24
125_A	131_E	0.575	0.23
28_E	85_T	0.574	0.23
43_V	62_T	0.573	0.23
32_M	67_D	0.571	0.23
62_T	66_I	0.569	0.23
41_N	66_I	0.567	0.23
140_S	144_T	0.566	0.23
132_F	150_S	0.562	0.23
108_R	140_S	0.559	0.23
43_V	51_G	0.558	0.23
132_F	138_D	0.558	0.23
149_S	152_T	0.556	0.22
31_S	50_H	0.553	0.22
140_S	145_I	0.552	0.22
22_L	94_Q	0.550	0.22
27_K	127_S	0.550	0.22
22_L	71_L	0.546	0.22
41_N	152_T	0.540	0.22
138_D	155_I	0.539	0.22
44_D	60_D	0.537	0.22
146_D	149_S	0.537	0.22
24_G	94_Q	0.535	0.21
6_E	17_D	0.533	0.21
70_L	102_E	0.531	0.21
73_E	106_Y	0.530	0.21
95_E	143_E	0.528	0.21
20_K	24_G	0.527	0.21
43_V	46_H	0.525	0.21
58_M	63_V	0.524	0.21
38_E	129_E	0.517	0.21
39_L	126_P	0.517	0.21
36_V	158_R	0.516	0.20
153_Y	157_D	0.513	0.20
21_E	67_D	0.510	0.20
59_T	150_S	0.509	0.20
25_E	29_T	0.507	0.20
96_I	100_R	0.504	0.20
5_K	17_D	0.503	0.20
13_H	142_K	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ijjA	1	0.7239	100	0.513	Contact Map
1tjlA	2	0.7485	100	0.53	Contact Map
2kq9A	1	0.6626	99.9	0.579	Contact Map
2kgoA	1	0.5276	99.8	0.655	Contact Map
1lkoA	3	0.7301	52.8	0.937	Contact Map
2gviA	3	0.5644	49.3	0.938	Contact Map
3w0fA	1	0.681	48	0.939	Contact Map
3pwfA	4	0.6748	44.3	0.94	Contact Map
1k3xA	1	0.6442	41.8	0.941	Contact Map
2lo3A	1	0.2699	37.4	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.