GS14 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GS14 - General stress protein 14

UniProt:	P80871	Sequences: MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	175 (166)
Sequences:	3733 (2663)
Seq/√Len:	206.7

ECOLI - KEFG KEFF YCAK MDAB AZOR
BACSU - GS14 YRKL YDEQ AZOR2 AZOR1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_T	56_E	3.705	1.00
8_V	74_L	2.459	1.00
77_K	81_L	2.453	1.00
34_R	53_L	2.433	1.00
2_K	30_N	2.377	1.00
35_D	38_K	2.370	1.00
51_Q	87_W	2.181	1.00
32_T	53_L	2.114	1.00
101_L	135_S	2.107	1.00
66_L	105_V	2.085	1.00
7_A	18_N	2.027	1.00
59_R	100_E	2.023	1.00
34_R	39_E	1.968	1.00
52_Q	56_E	1.960	1.00
100_E	141_K	1.925	1.00
43_E	77_K	1.909	1.00
48_A	52_Q	1.906	1.00
3_I	59_R	1.889	1.00
60_I	140_M	1.860	1.00
22_A	26_S	1.855	1.00
55_E	87_W	1.802	1.00
52_Q	55_E	1.801	1.00
156_A	160_S	1.762	1.00
155_A	158_D	1.756	1.00
76_K	80_D	1.756	1.00
4_L	53_L	1.746	1.00
19_K	23_E	1.744	1.00
49_K	53_L	1.730	1.00
2_K	56_E	1.695	1.00
123_S	126_E	1.667	1.00
73_P	77_K	1.631	1.00
32_T	57_Y	1.627	1.00
8_V	37_Y	1.626	1.00
39_E	53_L	1.619	1.00
24_E	167_A	1.573	1.00
5_V	22_A	1.571	1.00
50_E	78_W	1.571	1.00
164_K	167_A	1.549	1.00
23_E	26_S	1.538	1.00
79_Q	83_L	1.486	1.00
17_V	106_S	1.463	1.00
51_Q	88_A	1.434	1.00
104_A	166_L	1.421	1.00
4_L	57_Y	1.417	1.00
63_Q	166_L	1.413	1.00
101_L	140_M	1.408	1.00
160_S	164_K	1.384	1.00
24_E	27_K	1.365	1.00
23_E	27_K	1.357	1.00
20_A	24_E	1.351	1.00
97_H	139_G	1.344	1.00
34_R	50_E	1.332	1.00
154_A	159_I	1.317	1.00
39_E	49_K	1.316	1.00
94_N	97_H	1.306	1.00
161_H	165_R	1.304	1.00
162_S	165_R	1.302	1.00
18_N	33_V	1.294	1.00
49_K	52_Q	1.287	1.00
124_I	147_V	1.282	1.00
47_V	51_Q	1.266	1.00
90_G	93_G	1.258	1.00
66_L	124_I	1.237	1.00
63_Q	104_A	1.228	1.00
46_D	49_K	1.225	1.00
3_I	29_D	1.219	1.00
146_Y	165_R	1.217	1.00
135_S	140_M	1.215	1.00
166_L	170_I	1.168	1.00
14_T	106_S	1.155	1.00
8_V	75_L	1.151	1.00
37_Y	74_L	1.150	1.00
164_K	168_E	1.147	1.00
148_F	154_A	1.135	1.00
126_E	129_K	1.133	1.00
39_E	50_E	1.124	1.00
20_A	167_A	1.123	1.00
111_A	115_Q	1.114	1.00
104_A	146_Y	1.114	1.00
158_D	161_H	1.112	1.00
61_V	102_M	1.111	1.00
57_Y	60_I	1.110	1.00
111_A	149_Y	1.109	1.00
14_T	63_Q	1.096	1.00
90_G	95_A	1.087	1.00
133_A	136_N	1.072	1.00
71_S	75_L	1.072	1.00
21_W	25_L	1.065	1.00
20_A	23_E	1.065	1.00
98_G	141_K	1.056	1.00
24_E	28_H	1.051	1.00
22_A	33_V	1.042	1.00
96_L	140_M	1.035	1.00
83_L	138_I	1.029	1.00
53_L	56_E	1.027	1.00
48_A	51_Q	1.027	1.00
107_T	149_Y	1.024	1.00
6_L	34_R	1.004	1.00
64_F	103_L	0.997	1.00
148_F	162_S	0.996	1.00
58_D	99_K	0.978	1.00
16_V	156_A	0.975	1.00
41_P	44_A	0.946	0.99
51_Q	84_T	0.936	0.99
7_A	15_S	0.935	0.99
30_N	56_E	0.929	0.99
110_E	113_K	0.927	0.99
159_I	163_A	0.927	0.99
55_E	95_A	0.924	0.99
8_V	36_L	0.910	0.99
27_K	167_A	0.903	0.99
15_S	18_N	0.900	0.99
68_W	80_D	0.893	0.99
85_Y	89_F	0.875	0.99
10_P	67_Y	0.871	0.99
41_P	77_K	0.866	0.99
105_V	128_L	0.858	0.99
16_V	163_A	0.855	0.99
26_S	30_N	0.854	0.99
127_L	133_A	0.852	0.99
100_E	143_L	0.846	0.99
41_P	45_I	0.846	0.99
23_E	167_A	0.841	0.99
107_T	124_I	0.839	0.99
166_L	169_Y	0.821	0.98
2_K	58_D	0.820	0.98
105_V	147_V	0.817	0.98
161_H	164_K	0.815	0.98
59_R	102_M	0.805	0.98
79_Q	134_T	0.800	0.98
107_T	147_V	0.797	0.98
69_Y	137_L	0.792	0.98
34_R	78_W	0.788	0.98
104_A	148_F	0.784	0.98
129_K	132_Q	0.782	0.98
64_F	124_I	0.766	0.98
66_L	127_L	0.764	0.98
16_V	159_I	0.761	0.97
102_M	146_Y	0.760	0.97
18_N	63_Q	0.754	0.97
134_T	138_I	0.752	0.97
54_C	60_I	0.749	0.97
12_M	38_K	0.747	0.97
85_Y	91_S	0.744	0.97
66_L	114_Y	0.743	0.97
73_P	81_L	0.743	0.97
154_A	158_D	0.732	0.97
62_F	135_S	0.731	0.97
20_A	160_S	0.720	0.96
144_P	169_Y	0.720	0.96
102_M	169_Y	0.719	0.96
109_S	120_N	0.718	0.96
54_C	78_W	0.717	0.96
21_W	104_A	0.716	0.96
2_K	35_D	0.714	0.96
135_S	142_Y	0.711	0.96
5_V	61_V	0.710	0.96
46_D	50_E	0.708	0.96
43_E	81_L	0.694	0.96
165_R	168_E	0.693	0.96
101_L	142_Y	0.693	0.96
93_G	97_H	0.687	0.95
54_C	62_F	0.687	0.95
64_F	105_V	0.684	0.95
100_E	139_G	0.678	0.95
159_I	162_S	0.675	0.95
119_A	137_L	0.670	0.95
17_V	104_A	0.670	0.95
11_H	14_T	0.666	0.95
25_L	166_L	0.666	0.95
126_E	132_Q	0.664	0.94
50_E	53_L	0.662	0.94
68_W	89_F	0.659	0.94
40_Y	45_I	0.657	0.94
64_F	128_L	0.654	0.94
109_S	150_G	0.648	0.94
6_L	78_W	0.645	0.94
21_W	166_L	0.643	0.93
51_Q	82_V	0.637	0.93
41_P	81_L	0.636	0.93
20_A	163_A	0.635	0.93
64_F	75_L	0.620	0.92
8_V	35_D	0.618	0.92
86_G	90_G	0.615	0.92
21_W	148_F	0.610	0.92
94_N	139_G	0.607	0.91
6_L	62_F	0.606	0.91
16_V	20_A	0.606	0.91
44_A	77_K	0.604	0.91
107_T	114_Y	0.604	0.91
4_L	34_R	0.604	0.91
5_V	21_W	0.603	0.91
25_L	170_I	0.603	0.91
151_V	159_I	0.602	0.91
72_P	80_D	0.602	0.91
43_E	74_L	0.601	0.91
120_N	133_A	0.599	0.91
71_S	79_Q	0.599	0.91
21_W	170_I	0.598	0.91
48_A	161_H	0.598	0.91
157_E	161_H	0.593	0.90
69_Y	133_A	0.592	0.90
132_Q	145_P	0.591	0.90
93_G	96_L	0.591	0.90
51_Q	85_Y	0.577	0.89
15_S	19_K	0.576	0.89
146_Y	166_L	0.574	0.89
64_F	71_S	0.572	0.89
121_H	133_A	0.569	0.89
5_V	31_I	0.567	0.88
116_A	126_E	0.566	0.88
125_S	145_P	0.562	0.88
113_K	119_A	0.561	0.88
163_A	167_A	0.560	0.88
69_Y	109_S	0.556	0.87
75_L	79_Q	0.555	0.87
64_F	72_P	0.545	0.86
48_A	84_T	0.544	0.86
52_Q	168_E	0.543	0.86
114_Y	118_G	0.543	0.86
132_Q	142_Y	0.540	0.86
74_L	78_W	0.539	0.86
69_Y	120_N	0.539	0.86
108_G	152_N	0.534	0.85
11_H	81_L	0.533	0.85
54_C	83_L	0.532	0.85
7_A	12_M	0.531	0.85
20_A	164_K	0.531	0.85
25_L	28_H	0.531	0.85
43_E	73_P	0.529	0.85
7_A	33_V	0.528	0.85
86_G	91_S	0.527	0.84
81_L	84_T	0.526	0.84
62_F	128_L	0.525	0.84
61_V	166_L	0.525	0.84
17_V	162_S	0.524	0.84
118_G	126_E	0.522	0.84
163_A	166_L	0.520	0.84
71_S	134_T	0.519	0.84
146_Y	169_Y	0.518	0.83
88_A	96_L	0.517	0.83
71_S	128_L	0.513	0.83
100_E	142_Y	0.510	0.83
103_L	128_L	0.509	0.82
24_E	170_I	0.508	0.82
64_F	138_I	0.503	0.82
51_Q	89_F	0.502	0.82
128_L	145_P	0.501	0.81
44_A	74_L	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1d4aA	2	0.9943	100	0.358	Contact Map
4gi5A	2	0.9943	100	0.38	Contact Map
2amjA	2	0.9429	100	0.412	Contact Map
3l9wA	2	0.9886	100	0.424	Contact Map
4fglA	2	0.9943	100	0.425	Contact Map
3rpeA	2	0.96	100	0.441	Contact Map
3f2vA	2	0.9714	100	0.442	Contact Map
3ha2A	2	0.9429	100	0.445	Contact Map
3lcmA	2	0.9657	100	0.448	Contact Map
4r81A	4	0.9771	100	0.472	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.