GS13 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GS13 - General stress protein 13

UniProt:	P80870	Sequences: MAAKFEVGSVYTGKVTGLQAYGAFVALDEETQGLVHISEVTHGFVKDINEHLSVGDEVQVKVLAVDEEKGKISLSIRATQAAPEKKESKPRKPKAAQVSEEASTPQGFNTLKDKLEEWIEMSNRKDLIKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (109)
Sequences:	2528 (2225)
Seq/√Len:	213.1

ECOLI - YHGF PNP RS1
BACSU - GS13 RS1H YABR PNP YDCI
HALSA - IF2A Q9HNL1
SULSO - IF2A Q980A3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_T	57_E	4.226	1.00
12_T	59_Q	3.968	1.00
10_V	61_K	2.857	1.00
14_K	57_E	2.698	1.00
66_D	69_K	2.659	1.00
6_E	9_S	2.564	1.00
33_G	74_L	2.520	1.00
53_S	56_D	2.497	1.00
46_K	50_E	2.223	1.00
13_G	25_V	2.074	1.00
27_L	74_L	2.057	1.00
39_E	80_Q	1.963	1.00
40_V	52_L	1.905	1.00
21_Y	34_L	1.859	1.00
47_D	50_E	1.853	1.00
10_V	59_Q	1.845	1.00
63_L	75_S	1.689	1.00
35_V	76_I	1.648	1.00
40_V	48_I	1.627	1.00
39_E	78_A	1.622	1.00
23_A	52_L	1.622	1.00
5_F	62_V	1.514	1.00
21_Y	36_H	1.494	1.00
84_E	87_E	1.461	1.00
42_H	79_T	1.453	1.00
64_A	73_S	1.433	1.00
92_K	95_A	1.389	1.00
5_F	28_D	1.383	1.00
108_F	111_L	1.349	1.00
109_N	112_K	1.329	1.00
58_V	76_I	1.314	1.00
105_P	108_F	1.288	1.00
18_L	52_L	1.276	1.00
99_S	102_A	1.265	1.00
75_S	80_Q	1.229	1.00
94_K	97_Q	1.223	1.00
39_E	64_A	1.203	1.00
97_Q	100_E	1.201	1.00
26_A	30_E	1.127	1.00
20_A	49_N	1.126	1.00
105_P	111_L	1.124	1.00
49_N	54_V	1.124	1.00
40_V	76_I	1.081	1.00
107_G	110_T	1.080	1.00
107_G	111_L	1.075	1.00
85_K	88_S	1.073	1.00
98_V	101_E	1.063	1.00
35_V	60_V	1.059	1.00
18_L	48_I	1.047	1.00
26_A	29_E	1.029	1.00
24_F	34_L	1.001	1.00
21_Y	24_F	0.990	1.00
10_V	79_T	0.982	1.00
13_G	74_L	0.978	1.00
98_V	103_S	0.964	1.00
25_V	35_V	0.959	1.00
63_L	73_S	0.956	1.00
91_R	94_K	0.944	1.00
87_E	92_K	0.921	0.99
11_Y	60_V	0.920	0.99
88_S	91_R	0.916	0.99
42_H	83_P	0.902	0.99
39_E	77_R	0.902	0.99
104_T	107_G	0.900	0.99
22_G	34_L	0.892	0.99
27_L	72_I	0.891	0.99
8_G	82_A	0.890	0.99
11_Y	62_V	0.885	0.99
84_E	88_S	0.876	0.99
92_K	100_E	0.860	0.99
27_L	46_K	0.858	0.99
105_P	109_N	0.856	0.99
16_T	26_A	0.851	0.99
15_V	52_L	0.847	0.99
62_V	65_V	0.845	0.99
90_P	94_K	0.831	0.99
100_E	104_T	0.831	0.99
106_Q	111_L	0.819	0.99
103_S	108_F	0.817	0.99
34_L	38_S	0.810	0.98
95_A	98_V	0.803	0.98
45_V	51_H	0.793	0.98
43_G	51_H	0.792	0.98
26_A	32_Q	0.785	0.98
103_S	107_G	0.784	0.98
86_K	93_P	0.773	0.98
36_H	73_S	0.765	0.98
31_T	67_E	0.765	0.98
43_G	50_E	0.757	0.98
86_K	92_K	0.755	0.98
41_T	45_V	0.748	0.97
108_F	112_K	0.730	0.97
105_P	110_T	0.729	0.97
60_V	76_I	0.727	0.97
96_A	99_S	0.723	0.97
103_S	109_N	0.720	0.97
85_K	93_P	0.715	0.97
23_A	48_I	0.712	0.97
96_A	104_T	0.702	0.96
5_F	32_Q	0.701	0.96
18_L	54_V	0.701	0.96
89_K	102_A	0.696	0.96
104_T	110_T	0.695	0.96
93_P	102_A	0.689	0.96
100_E	105_P	0.674	0.95
61_K	78_A	0.673	0.95
86_K	90_P	0.668	0.95
89_K	93_P	0.666	0.95
92_K	102_A	0.663	0.95
103_S	111_L	0.658	0.95
102_A	108_F	0.653	0.94
24_F	36_H	0.647	0.94
23_A	51_H	0.636	0.94
90_P	93_P	0.632	0.93
48_I	52_L	0.630	0.93
21_Y	41_T	0.630	0.93
88_S	105_P	0.627	0.93
101_E	104_T	0.624	0.93
7_V	64_A	0.624	0.93
94_K	98_V	0.620	0.93
5_F	11_Y	0.619	0.93
93_P	97_Q	0.617	0.93
106_Q	110_T	0.612	0.92
88_S	92_K	0.611	0.92
86_K	89_K	0.611	0.92
106_Q	109_N	0.610	0.92
87_E	90_P	0.609	0.92
29_E	32_Q	0.606	0.92
93_P	99_S	0.606	0.92
96_A	100_E	0.602	0.92
77_R	81_A	0.601	0.92
81_A	84_E	0.599	0.91
104_T	108_F	0.599	0.91
104_T	112_K	0.596	0.91
16_T	73_S	0.594	0.91
10_V	78_A	0.589	0.91
37_I	45_V	0.589	0.91
98_V	106_Q	0.588	0.91
54_V	57_E	0.586	0.91
16_T	32_Q	0.585	0.91
85_K	91_R	0.584	0.90
97_Q	102_A	0.581	0.90
107_G	112_K	0.581	0.90
14_K	23_A	0.580	0.90
52_L	76_I	0.577	0.90
93_P	96_A	0.573	0.90
44_F	47_D	0.573	0.90
40_V	45_V	0.569	0.89
4_K	28_D	0.561	0.89
103_S	106_Q	0.561	0.89
70_G	73_S	0.561	0.89
25_V	58_V	0.560	0.89
87_E	91_R	0.555	0.88
97_Q	101_E	0.553	0.88
101_E	107_G	0.551	0.88
41_T	46_K	0.550	0.88
92_K	96_A	0.544	0.87
96_A	106_Q	0.542	0.87
34_L	73_S	0.520	0.85
21_Y	73_S	0.517	0.84
98_V	104_T	0.507	0.83
43_G	46_K	0.502	0.83
97_Q	109_N	0.501	0.82
85_K	89_K	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nbqA	3	0.5077	99.7	0.286	Contact Map
4aidA	3	0	99.7	0.287	Contact Map
3cdiA	3	0	99.7	0.289	Contact Map
3psfA	1	0.2385	99.7	0.292	Contact Map
1e3pA	3	0.3	99.7	0.31	Contact Map
3psiA	1	0.6308	99.7	0.313	Contact Map
2k4kA	1	0.9923	99.7	0.328	Contact Map
3bzcA	1	0.6385	99.7	0.339	Contact Map
2khjA	1	0.6538	99.7	0.34	Contact Map
2khiA	1	0.7	99.6	0.35	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.