ACP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ACP - Acyl carrier protein

UniProt:	P80643	Sequences: MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	77 (68)
Sequences:	23373 (18433)
Seq/√Len:	2235.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_E	67_G	2.370	1.00
7_R	50_E	2.319	1.00
56_S	59_D	2.146	1.00
63_I	72_Y	2.006	1.00
59_D	72_Y	1.929	1.00
14_D	46_E	1.920	1.00
65_T	68_D	1.880	1.00
36_D	39_D	1.759	1.00
28_S	64_A	1.752	1.00
5_L	25_L	1.734	1.00
29_F	35_A	1.663	1.00
12_I	35_A	1.641	1.00
24_K	27_A	1.579	1.00
48_E	54_E	1.515	1.00
7_R	10_K	1.460	1.00
9_T	25_L	1.450	1.00
9_T	66_V	1.438	1.00
11_I	46_E	1.386	1.00
11_I	14_D	1.372	1.00
63_I	68_D	1.364	1.00
28_S	32_D	1.342	1.00
4_T	74_Q	1.324	1.00
25_L	67_G	1.268	1.00
10_K	50_E	1.241	1.00
13_V	22_D	1.239	1.00
9_T	13_V	1.232	1.00
12_I	66_V	1.224	1.00
46_E	50_E	1.214	1.00
8_V	70_V	1.182	1.00
44_V	48_E	1.177	1.00
43_L	60_A	1.167	1.00
8_V	66_V	1.098	1.00
7_R	11_I	1.091	1.00
25_L	66_V	1.090	1.00
58_E	62_K	1.077	1.00
39_D	42_E	1.077	1.00
8_V	47_L	1.044	1.00
12_I	43_L	1.032	1.00
4_T	7_R	1.032	1.00
11_I	50_E	1.010	1.00
40_V	60_A	1.007	1.00
15_R	46_E	1.006	1.00
11_I	43_L	1.004	1.00
6_E	10_K	1.003	1.00
12_I	69_A	0.982	1.00
7_R	51_F	0.976	1.00
5_L	67_G	0.973	1.00
40_V	44_V	0.972	1.00
15_R	43_L	0.954	1.00
37_S	41_V	0.948	1.00
42_E	46_E	0.939	1.00
5_L	70_V	0.920	1.00
18_V	21_A	0.889	1.00
59_D	62_K	0.865	1.00
59_D	63_I	0.856	1.00
9_T	23_V	0.837	1.00
46_E	49_D	0.829	1.00
16_L	35_A	0.792	1.00
10_K	13_V	0.790	1.00
48_E	53_M	0.778	1.00
18_V	22_D	0.751	1.00
15_R	42_E	0.749	1.00
10_K	14_D	0.732	1.00
53_M	73_I	0.730	1.00
11_I	47_L	0.727	1.00
47_L	55_I	0.721	1.00
68_D	71_N	0.719	1.00
40_V	57_D	0.708	1.00
14_D	50_E	0.698	1.00
27_A	33_L	0.686	1.00
55_I	69_A	0.672	1.00
6_E	9_T	0.667	1.00
41_V	45_M	0.661	1.00
30_K	35_A	0.660	1.00
45_M	49_D	0.650	1.00
43_L	69_A	0.649	1.00
15_R	39_D	0.640	1.00
5_L	66_V	0.630	1.00
13_V	21_A	0.620	1.00
30_K	61_E	0.616	1.00
4_T	73_I	0.610	1.00
18_V	33_L	0.608	1.00
28_S	65_T	0.601	1.00
60_A	69_A	0.595	1.00
23_V	33_L	0.590	1.00
47_L	53_M	0.581	1.00
35_A	39_D	0.572	1.00
35_A	40_V	0.569	1.00
44_V	57_D	0.563	1.00
66_V	70_V	0.561	1.00
27_A	32_D	0.549	1.00
13_V	23_V	0.549	1.00
13_V	18_V	0.541	1.00
18_V	23_V	0.527	1.00
63_I	71_N	0.527	1.00
30_K	33_L	0.525	1.00
71_N	74_Q	0.524	1.00
37_S	61_E	0.523	1.00
4_T	51_F	0.519	1.00
64_A	68_D	0.510	1.00
17_G	42_E	0.507	1.00
5_L	9_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4r0mB	1	0.9221	99.6	0.072	Contact Map
2vsqA	1	0.961	99.6	0.086	Contact Map
2jgpA	1	0.961	99.6	0.09	Contact Map
4oqjA	2	0	99.5	0.096	Contact Map
4dg8A	1	0	99.5	0.129	Contact Map
4pxhB	1	0.9351	99.4	0.155	Contact Map
2cq8A	1	0.974	99.4	0.157	Contact Map
3tejA	1	0.9481	99.4	0.162	Contact Map
1dnyA	1	0.9351	99.4	0.164	Contact Map
2l22A	1	0.987	99.4	0.167	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.