OHRB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

OHRB - Organic hydroperoxide resistance protein OhrB

UniProt:	P80242	Sequences: MALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAKKEGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLELK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	136 (130)
Sequences:	1897 (1164)
Seq/√Len:	102.1

BACSU - OHRB OHRA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_Q	113_N	3.284	1.00
67_Q	114_A	3.155	1.00
104_D	107_K	3.093	1.00
105_R	109_Q	2.734	1.00
63_V	118_F	2.549	1.00
79_V	94_V	2.528	1.00
95_T	132_K	2.472	1.00
7_K	78_Q	2.455	1.00
100_T	108_A	2.348	1.00
97_V	134_E	2.297	1.00
80_S	93_G	2.192	1.00
18_I	50_A	2.127	1.00
57_G	73_S	2.089	1.00
77_G	96_L	2.055	1.00
78_Q	97_V	1.977	1.00
19_T	26_D	1.974	1.00
9_T	76_E	1.906	1.00
22_D	46_Q	1.900	1.00
95_T	134_E	1.880	1.00
110_E	114_A	1.716	1.00
98_V	112_V	1.713	1.00
82_M	93_G	1.696	1.00
17_H	28_D	1.690	1.00
67_Q	110_E	1.686	1.00
62_H	66_E	1.675	1.00
82_M	91_K	1.644	1.00
107_K	110_E	1.623	1.00
17_H	26_D	1.541	1.00
7_K	21_D	1.540	1.00
24_V	41_G	1.534	1.00
5_T	78_Q	1.490	1.00
60_L	111_L	1.463	1.00
69_I	107_K	1.460	1.00
18_I	27_F	1.446	1.00
125_T	129_V	1.378	1.00
57_G	61_E	1.376	1.00
10_A	18_I	1.371	0.99
52_Y	94_V	1.369	0.99
64_A	71_I	1.350	0.99
56_F	112_V	1.326	0.99
42_T	46_Q	1.321	0.99
8_V	20_S	1.307	0.99
19_T	23_G	1.304	0.99
6_A	21_D	1.297	0.99
53_A	77_G	1.286	0.99
124_A	128_N	1.254	0.99
113_N	117_E	1.231	0.99
93_G	132_K	1.230	0.99
10_A	53_A	1.210	0.99
7_K	76_E	1.203	0.99
78_Q	95_T	1.196	0.99
3_L	35_K	1.191	0.99
8_V	49_A	1.180	0.98
116_H	122_S	1.167	0.98
10_A	57_G	1.163	0.98
74_E	99_N	1.095	0.97
30_V	41_G	1.088	0.97
94_V	129_V	1.075	0.97
35_K	81_L	1.053	0.97
103_L	107_K	1.047	0.97
5_T	80_S	1.037	0.97
31_M	35_K	1.032	0.96
20_S	24_V	1.025	0.96
75_I	98_V	1.010	0.96
20_S	42_T	1.007	0.96
125_T	128_N	1.003	0.96
9_T	21_D	1.001	0.96
33_N	37_E	0.997	0.96
20_S	50_A	0.995	0.96
76_E	99_N	0.982	0.95
98_V	133_L	0.980	0.95
48_F	125_T	0.975	0.95
38_G	41_G	0.964	0.95
33_N	36_K	0.950	0.94
48_F	121_Y	0.943	0.94
116_H	131_V	0.934	0.94
117_E	126_R	0.926	0.94
65_K	70_E	0.919	0.93
30_V	40_T	0.916	0.93
87_D	123_K	0.909	0.93
62_H	118_F	0.895	0.92
80_S	95_T	0.883	0.92
106_E	109_Q	0.879	0.92
110_E	113_N	0.871	0.91
30_V	38_G	0.861	0.91
66_E	114_A	0.848	0.90
52_Y	122_S	0.844	0.90
91_K	130_D	0.841	0.90
64_A	111_L	0.839	0.90
65_K	68_N	0.837	0.90
15_A	31_M	0.815	0.88
83_K	123_K	0.804	0.88
58_G	61_E	0.798	0.87
24_V	42_T	0.788	0.87
24_V	38_G	0.786	0.86
58_G	92_I	0.777	0.86
62_H	65_K	0.767	0.85
34_A	39_Q	0.763	0.85
5_T	93_G	0.762	0.85
8_V	50_A	0.759	0.84
51_G	121_Y	0.754	0.84
93_G	129_V	0.749	0.84
30_V	34_A	0.749	0.84
56_F	133_L	0.749	0.84
60_L	98_V	0.747	0.83
4_F	43_N	0.745	0.83
60_L	67_Q	0.744	0.83
112_V	133_L	0.742	0.83
24_V	40_T	0.741	0.83
21_D	42_T	0.736	0.83
73_S	100_T	0.732	0.82
100_T	103_L	0.731	0.82
43_N	46_Q	0.723	0.81
60_L	115_A	0.719	0.81
118_F	123_K	0.718	0.81
34_A	37_E	0.711	0.80
24_V	30_V	0.711	0.80
29_I	64_A	0.711	0.80
57_G	74_E	0.694	0.79
58_G	62_H	0.693	0.79
109_Q	133_L	0.686	0.78
70_E	102_D	0.683	0.78
99_N	105_R	0.683	0.78
36_K	39_Q	0.681	0.77
72_D	101_K	0.674	0.77
25_L	42_T	0.662	0.75
6_A	75_I	0.658	0.75
62_H	90_F	0.652	0.74
58_G	81_L	0.643	0.73
89_G	123_K	0.643	0.73
114_A	117_E	0.639	0.73
55_C	116_H	0.639	0.73
83_K	87_D	0.631	0.72
4_F	35_K	0.628	0.72
113_N	133_L	0.627	0.71
13_G	16_G	0.626	0.71
67_Q	107_K	0.626	0.71
86_S	89_G	0.624	0.71
63_V	67_Q	0.622	0.71
126_R	131_V	0.619	0.70
106_E	110_E	0.619	0.70
52_Y	116_H	0.617	0.70
57_G	65_K	0.616	0.70
49_A	79_V	0.616	0.70
96_L	131_V	0.613	0.70
57_G	75_I	0.612	0.70
86_S	123_K	0.607	0.69
23_G	26_D	0.601	0.68
60_L	73_S	0.600	0.68
63_V	114_A	0.598	0.68
103_L	108_A	0.595	0.67
88_G	123_K	0.593	0.67
60_L	69_I	0.589	0.67
14_R	124_A	0.587	0.66
76_E	97_V	0.582	0.66
58_G	123_K	0.580	0.66
4_F	46_Q	0.579	0.65
27_F	42_T	0.572	0.64
9_T	74_E	0.566	0.64
48_F	79_V	0.566	0.64
123_K	126_R	0.565	0.64
64_A	73_S	0.562	0.63
6_A	78_Q	0.562	0.63
31_M	38_G	0.561	0.63
48_F	52_Y	0.559	0.63
91_K	123_K	0.558	0.63
53_A	57_G	0.557	0.62
28_D	40_T	0.552	0.62
29_I	42_T	0.546	0.61
26_D	50_A	0.545	0.61
48_F	131_V	0.542	0.60
11_R	74_E	0.536	0.59
83_K	90_F	0.534	0.59
24_V	39_Q	0.533	0.59
10_A	29_I	0.532	0.59
43_N	51_G	0.531	0.59
20_S	23_G	0.531	0.59
124_A	127_G	0.528	0.58
60_L	103_L	0.528	0.58
81_L	89_G	0.527	0.58
124_A	129_V	0.527	0.58
101_K	105_R	0.527	0.58
68_N	107_K	0.526	0.58
15_A	38_G	0.525	0.58
18_I	41_G	0.524	0.58
66_E	103_L	0.522	0.58
21_D	34_A	0.518	0.57
53_A	71_I	0.516	0.57
3_L	130_D	0.514	0.56
90_F	123_K	0.511	0.56
42_T	50_A	0.509	0.56
96_L	133_L	0.509	0.56
114_A	118_F	0.503	0.55
4_F	36_K	0.503	0.55
9_T	19_T	0.500	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bjoA	2	0.9853	100	0.452	Contact Map
4nozA	2	0.9853	100	0.453	Contact Map
1n2fA	2	0.9853	100	0.46	Contact Map
1uspA	2	0.9853	100	0.464	Contact Map
1zb9A	2	0.9853	100	0.474	Contact Map
2ql8A	2	0.9559	100	0.475	Contact Map
3eerA	2	0.9853	100	0.479	Contact Map
4mh4A	2	0.9632	100	0.483	Contact Map
1nyeA	5	0.9632	100	0.487	Contact Map
2d7vA	2	0.9853	100	0.494	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.