G17M - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

G17M - General stress protein 17M

UniProt:	P80241	Sequences: MKPVVKEYTNDEQLMKDVEELQKMGVAKEDVYVLAHDDDRTERLADNTNANTIGAKETGFKHAVGNIFNKKGDELRNKIHEIGFSEDEAAQFEKRLDEGKVLLFVTDNEKVKAWA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	115 (105)
Sequences:	155 (126)
Seq/√Len:	12.3

BACSU - G17M

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
95_R	98_E	3.835	0.99
72_G	76_R	2.934	0.95
34_L	53_I	2.741	0.93
72_G	97_D	2.724	0.93
76_R	97_D	2.718	0.93
33_V	44_L	2.650	0.92
36_H	93_E	2.334	0.86
14_L	35_A	2.174	0.82
36_H	97_D	2.173	0.82
36_H	72_G	2.080	0.78
69_N	103_L	2.020	0.76
45_A	50_A	1.967	0.74
67_I	104_F	1.939	0.73
53_I	82_I	1.921	0.73
34_L	41_T	1.900	0.72
41_T	45_A	1.853	0.70
5_V	92_F	1.839	0.69
32_Y	57_E	1.799	0.67
59_G	96_L	1.724	0.64
72_G	93_E	1.588	0.57
80_H	86_E	1.523	0.54
101_V	104_F	1.480	0.52
15_M	19_E	1.445	0.50
36_H	73_D	1.433	0.49
84_F	92_F	1.417	0.49
66_N	89_A	1.417	0.49
26_V	105_V	1.408	0.48
39_D	43_R	1.402	0.48
93_E	97_D	1.401	0.48
66_N	102_L	1.370	0.46
21_L	100_K	1.350	0.45
45_A	52_T	1.322	0.44
21_L	103_L	1.311	0.43
34_L	102_L	1.256	0.41
54_G	57_E	1.241	0.40
28_K	44_L	1.212	0.38
69_N	77_N	1.203	0.38
8_Y	105_V	1.170	0.36
88_E	92_F	1.151	0.36
28_K	65_G	1.107	0.34
23_K	77_N	1.105	0.33
11_D	105_V	1.087	0.33
36_H	76_R	1.074	0.32
78_K	104_F	1.068	0.32
30_D	107_D	1.060	0.31
65_G	69_N	1.057	0.31
8_Y	35_A	1.044	0.31
73_D	88_E	1.044	0.31
26_V	77_N	1.037	0.30
44_L	71_K	1.018	0.30
16_K	20_E	1.013	0.29
14_L	61_K	1.001	0.29
44_L	101_V	1.001	0.29
25_G	66_N	0.991	0.28
12_E	38_D	0.989	0.28
44_L	91_Q	0.987	0.28
17_D	24_M	0.978	0.28
25_G	102_L	0.973	0.28
36_H	75_L	0.972	0.28
23_K	59_G	0.969	0.28
55_A	91_Q	0.961	0.27
22_Q	56_K	0.941	0.26
58_T	74_E	0.924	0.26
44_L	48_T	0.909	0.25
57_E	78_K	0.900	0.25
63_A	82_I	0.870	0.24
27_A	86_E	0.849	0.23
36_H	89_A	0.849	0.23
30_D	65_G	0.844	0.23
38_D	71_K	0.840	0.23
77_N	103_L	0.837	0.23
28_K	92_F	0.823	0.22
22_Q	31_V	0.819	0.22
42_E	86_E	0.812	0.22
18_V	102_L	0.791	0.21
76_R	93_E	0.790	0.21
85_S	98_E	0.789	0.21
54_G	72_G	0.786	0.21
11_D	28_K	0.786	0.21
7_E	95_R	0.784	0.21
37_D	43_R	0.780	0.21
89_A	97_D	0.774	0.20
5_V	65_G	0.770	0.20
56_K	85_S	0.761	0.20
53_I	78_K	0.755	0.20
6_K	51_N	0.749	0.20
5_V	103_L	0.742	0.19
34_L	65_G	0.742	0.19
25_G	100_K	0.737	0.19
50_A	79_I	0.734	0.19
8_Y	11_D	0.730	0.19
79_I	102_L	0.727	0.19
17_D	20_E	0.725	0.19
19_E	63_A	0.724	0.19
19_E	32_Y	0.718	0.19
69_N	92_F	0.718	0.19
6_K	84_F	0.716	0.19
62_H	95_R	0.714	0.18
10_N	21_L	0.708	0.18
46_D	49_N	0.707	0.18
23_K	31_V	0.705	0.18
8_Y	81_E	0.690	0.18
19_E	88_E	0.685	0.18
49_N	58_T	0.684	0.18
48_T	79_I	0.684	0.18
54_G	97_D	0.683	0.18
104_F	108_N	0.676	0.17
62_H	92_F	0.664	0.17
87_D	104_F	0.662	0.17
85_S	100_K	0.661	0.17
96_L	99_G	0.661	0.17
37_D	52_T	0.658	0.17
34_L	101_V	0.643	0.16
6_K	102_L	0.637	0.16
24_M	85_S	0.636	0.16
39_D	55_A	0.631	0.16
16_K	19_E	0.630	0.16
41_T	78_K	0.628	0.16
4_V	101_V	0.620	0.16
4_V	24_M	0.620	0.16
20_E	103_L	0.618	0.16
58_T	65_G	0.615	0.16
41_T	74_E	0.607	0.15
18_V	61_K	0.606	0.15
53_I	68_F	0.605	0.15
66_N	69_N	0.601	0.15
5_V	96_L	0.597	0.15
54_G	89_A	0.595	0.15
52_T	70_K	0.595	0.15
55_A	60_F	0.593	0.15
75_L	93_E	0.589	0.15
56_K	88_E	0.588	0.15
44_L	100_K	0.585	0.15
6_K	17_D	0.583	0.15
7_E	81_E	0.578	0.15
29_E	105_V	0.577	0.15
27_A	30_D	0.568	0.14
67_I	87_D	0.564	0.14
33_V	46_D	0.559	0.14
75_L	89_A	0.553	0.14
32_Y	49_N	0.552	0.14
30_D	108_N	0.550	0.14
23_K	86_E	0.548	0.14
17_D	105_V	0.544	0.14
33_V	45_A	0.543	0.14
62_H	81_E	0.537	0.14
42_E	52_T	0.533	0.14
17_D	98_E	0.526	0.13
42_E	90_A	0.526	0.13
65_G	103_L	0.519	0.13
24_M	98_E	0.517	0.13
25_G	67_I	0.512	0.13
87_D	91_Q	0.509	0.13
6_K	61_K	0.505	0.13
67_I	92_F	0.502	0.13
35_A	71_K	0.502	0.13
62_H	101_V	0.501	0.13
13_Q	46_D	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3m66A	1	0.9304	62.8	0.914	Contact Map
4pevA	1	0.9913	44.6	0.923	Contact Map
3gt0A	3	0.8522	43.7	0.923	Contact Map
2rcyA	5	0.8348	37.3	0.926	Contact Map
4wjiA	2	0.8696	36.3	0.927	Contact Map
3triA	2	0.8696	29.4	0.93	Contact Map
4pz0A	1	0.9913	28.5	0.931	Contact Map
4m9dA	2	0.9565	24.8	0.933	Contact Map
3etfA	3	0.8174	23.2	0.934	Contact Map
3mvaO	1	0.9652	23.1	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.