AHPC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AHPC - Alkyl hydroperoxide reductase subunit C

UniProt:	P80239	Sequences: MSLIGKEVLPFEAKAFKNGEFIDVTNEDLKGQWSVFCFYPADFSFVCPTELEDLQEQYAALKELGVEVYSVSTDTHFVHKGWHDSSEKISKITYAMIGDPSQTISRNFDVLDEETGLADRGTFIIDPDGVIQTVEINAGGIGRDASNLVNKVKAAQYVRQNPGEVCPAKWEEGGETLTPSLDLVGKI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	187 (147)
Sequences:	9044 (5118)
Seq/√Len:	422.1

ECOLI - AHPC BCP TPX
BACSU - AHPC YKUU BCP TPX
HALSA - Q9HP28 Q9HQE6 Q9HN00
SULSO - TDXH Q97VL0 Q97WG5 Q97WP9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_W	127_P	3.094	1.00
12_E	23_D	3.005	1.00
64_L	153_K	2.970	1.00
42_D	79_H	2.831	1.00
8_V	108_F	2.608	1.00
12_E	25_T	2.519	1.00
58_Y	62_K	2.406	1.00
126_D	132_Q	2.328	1.00
32_Q	67_E	2.308	1.00
55_Q	93_T	2.225	1.00
112_D	119_D	2.192	1.00
14_K	23_D	2.108	1.00
7_E	130_V	2.101	1.00
3_L	6_K	1.940	1.00
57_Q	60_A	1.920	1.00
18_N	22_I	1.832	1.00
10_P	27_E	1.828	1.00
103_T	107_N	1.787	1.00
73_T	102_Q	1.784	1.00
58_Y	93_T	1.744	1.00
25_T	28_D	1.715	1.00
73_T	105_S	1.711	1.00
13_A	104_I	1.682	1.00
13_A	97_I	1.676	1.00
57_Q	145_A	1.653	1.00
66_V	152_V	1.649	1.00
133_T	151_K	1.643	1.00
43_F	90_S	1.583	1.00
24_V	29_L	1.559	1.00
19_G	83_H	1.526	1.00
10_P	25_T	1.498	1.00
126_D	130_V	1.493	1.00
62_K	67_E	1.472	1.00
43_F	81_G	1.429	1.00
14_K	76_H	1.429	1.00
55_Q	94_Y	1.426	1.00
105_S	118_A	1.420	1.00
60_A	63_E	1.403	1.00
73_T	118_A	1.351	1.00
102_Q	106_R	1.350	1.00
80_K	84_D	1.349	1.00
59_A	63_E	1.325	1.00
51_L	92_I	1.323	1.00
70_S	96_M	1.268	1.00
30_K	34_S	1.264	1.00
49_T	142_G	1.249	1.00
135_E	151_K	1.243	1.00
52_E	56_E	1.239	1.00
35_V	124_I	1.236	1.00
29_L	34_S	1.211	1.00
34_S	69_Y	1.208	1.00
57_Q	146_S	1.197	1.00
18_N	95_A	1.196	1.00
59_A	62_K	1.193	1.00
2_S	131_I	1.180	1.00
33_W	66_V	1.172	1.00
147_N	150_N	1.168	1.00
38_F	71_V	1.166	1.00
29_L	69_Y	1.148	1.00
102_Q	111_L	1.135	1.00
106_R	111_L	1.127	1.00
43_F	85_S	1.120	1.00
146_S	150_N	1.092	1.00
34_S	67_E	1.084	1.00
85_S	90_S	1.084	1.00
110_V	123_F	1.083	1.00
110_V	121_G	1.069	1.00
52_E	55_Q	1.056	1.00
132_Q	138_A	1.053	1.00
151_K	154_A	1.051	1.00
77_F	81_G	1.036	1.00
37_C	51_L	1.029	1.00
125_I	131_I	1.029	1.00
60_A	149_V	1.023	1.00
104_I	108_F	1.022	1.00
67_E	95_A	0.992	1.00
35_V	122_T	0.986	1.00
4_I	133_T	0.985	1.00
37_C	94_Y	0.985	1.00
53_D	57_Q	0.981	1.00
60_A	153_K	0.976	1.00
75_T	78_V	0.970	1.00
33_W	132_Q	0.962	1.00
76_H	98_G	0.955	1.00
80_K	83_H	0.952	1.00
124_I	151_K	0.950	1.00
26_N	34_S	0.947	1.00
65_G	127_P	0.945	1.00
102_Q	105_S	0.940	1.00
35_V	66_V	0.936	1.00
8_V	131_I	0.928	1.00
30_K	129_G	0.923	1.00
150_N	153_K	0.921	1.00
7_E	30_K	0.911	1.00
124_I	135_E	0.909	1.00
81_G	84_D	0.906	1.00
123_F	131_I	0.905	1.00
43_F	78_V	0.901	1.00
149_V	153_K	0.895	1.00
61_L	149_V	0.893	1.00
11_F	108_F	0.888	1.00
143_R	146_S	0.885	1.00
14_K	100_P	0.877	1.00
8_V	125_I	0.877	1.00
4_I	134_V	0.862	1.00
10_P	26_N	0.861	1.00
20_E	80_K	0.851	1.00
55_Q	58_Y	0.841	1.00
54_L	148_L	0.838	1.00
71_V	104_I	0.838	1.00
34_S	129_G	0.833	1.00
39_Y	42_D	0.832	1.00
150_N	154_A	0.817	1.00
54_L	68_V	0.812	1.00
11_F	104_I	0.808	1.00
50_E	54_L	0.808	1.00
75_T	100_P	0.808	1.00
27_E	30_K	0.806	1.00
53_D	56_E	0.805	1.00
49_T	52_E	0.802	1.00
140_G	143_R	0.801	1.00
24_V	69_Y	0.801	1.00
36_F	108_F	0.800	1.00
105_S	111_L	0.788	1.00
121_G	136_I	0.786	1.00
8_V	26_N	0.782	1.00
18_N	21_F	0.775	1.00
103_T	106_R	0.774	1.00
132_Q	155_A	0.769	1.00
60_A	64_L	0.767	1.00
135_E	148_L	0.765	1.00
33_W	152_V	0.757	1.00
52_E	90_S	0.750	1.00
34_S	125_I	0.746	1.00
64_L	149_V	0.740	1.00
35_V	148_L	0.734	1.00
51_L	70_S	0.728	1.00
36_F	125_I	0.727	1.00
133_T	147_N	0.726	1.00
41_A	74_D	0.717	1.00
18_N	24_V	0.716	1.00
4_I	131_I	0.713	1.00
64_L	152_V	0.713	1.00
122_T	148_L	0.709	1.00
57_Q	61_L	0.708	1.00
8_V	104_I	0.707	1.00
69_Y	97_I	0.705	1.00
119_D	137_N	0.703	1.00
36_F	71_V	0.702	1.00
112_D	115_T	0.700	1.00
119_D	138_A	0.698	1.00
31_G	127_P	0.695	1.00
33_W	65_G	0.693	1.00
143_R	147_N	0.689	1.00
40_P	44_S	0.689	1.00
41_A	117_L	0.688	1.00
9_L	107_N	0.686	1.00
10_P	30_K	0.682	1.00
124_I	133_T	0.675	1.00
29_L	67_E	0.673	1.00
59_A	93_T	0.664	0.99
131_I	134_V	0.660	0.99
54_L	145_A	0.650	0.99
114_E	117_L	0.648	0.99
37_C	70_S	0.646	0.99
39_Y	70_S	0.644	0.99
51_L	94_Y	0.642	0.99
58_Y	68_V	0.636	0.99
42_D	78_V	0.626	0.99
57_Q	149_V	0.615	0.99
113_E	116_G	0.613	0.99
77_F	80_K	0.604	0.99
121_G	134_V	0.602	0.99
134_V	137_N	0.600	0.99
53_D	145_A	0.599	0.99
44_S	120_R	0.594	0.99
20_E	83_H	0.585	0.99
19_G	95_A	0.585	0.99
2_S	6_K	0.575	0.99
3_L	134_V	0.570	0.98
121_G	137_N	0.569	0.98
76_H	80_K	0.569	0.98
41_A	75_T	0.567	0.98
38_F	108_F	0.564	0.98
141_I	154_A	0.562	0.98
8_V	34_S	0.558	0.98
119_D	139_G	0.558	0.98
62_K	93_T	0.556	0.98
58_Y	67_E	0.555	0.98
104_I	107_N	0.553	0.98
45_F	48_P	0.552	0.98
26_N	29_L	0.552	0.98
37_C	50_E	0.551	0.98
53_D	146_S	0.551	0.98
38_F	110_V	0.550	0.98
135_E	147_N	0.550	0.98
73_T	111_L	0.549	0.98
39_Y	82_W	0.545	0.98
141_I	155_A	0.543	0.98
11_F	125_I	0.542	0.98
69_Y	95_A	0.541	0.98
40_P	120_R	0.541	0.98
35_V	152_V	0.540	0.98
21_F	80_K	0.537	0.98
66_V	148_L	0.534	0.98
61_L	66_V	0.534	0.98
97_I	104_I	0.533	0.98
40_P	82_W	0.530	0.98
39_Y	79_H	0.528	0.97
78_V	81_G	0.524	0.97
46_V	141_I	0.522	0.97
138_A	142_G	0.520	0.97
6_K	131_I	0.517	0.97
6_K	134_V	0.509	0.97
37_C	79_H	0.507	0.97
122_T	144_D	0.506	0.97
117_L	139_G	0.506	0.97
82_W	120_R	0.505	0.97
49_T	141_I	0.501	0.97
68_V	94_Y	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2v2gA	2	0.9733	100	0.275	Contact Map
3a2vA	5	0.9733	100	0.275	Contact Map
3w6gA	6	0.9679	100	0.282	Contact Map
1prxA	2	0.9733	100	0.284	Contact Map
1xccA	2	0.9733	100	0.286	Contact Map
3tjjA	3	0.8663	100	0.388	Contact Map
2c0dA	2	0.8877	100	0.397	Contact Map
2pn8A	4	0.9893	100	0.403	Contact Map
4rqxA	3	0.8663	100	0.408	Contact Map
3zl5A	3	0.8556	100	0.411	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.