GS26 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GS26 - General stress protein 26

UniProt:	P80238	Sequences: MNQQDIKQKVLDVLDHHKVGSLATVQKGKPHSRYMTFFHDGLTIYTPTSKETHKAEEIENNPNVHILLGYDCEGFGDAYVEVAGKAKINNSAELKDKIWSSKLERWFDGKDDPNLVILEIEPEDIRLMNAGEKTPVSLEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	140 (134)
Sequences:	161 (128)
Seq/√Len:	11.0

BACSU - GS26

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_G	120_I	4.955	1.00
22_L	64_V	4.821	1.00
63_N	85_K	3.128	0.96
42_L	80_V	3.091	0.95
64_V	86_A	2.603	0.89
10_V	42_L	2.313	0.82
20_G	37_F	2.290	0.81
26_Q	60_N	2.201	0.79
17_H	115_L	2.098	0.75
96_D	110_K	2.046	0.73
92_A	96_D	2.015	0.72
95_K	115_L	1.841	0.65
32_S	68_L	1.830	0.64
87_K	91_S	1.793	0.62
49_S	114_N	1.766	0.61
49_S	76_G	1.740	0.60
36_T	84_G	1.713	0.59
64_V	115_L	1.680	0.57
43_T	119_E	1.599	0.53
46_T	135_P	1.589	0.53
89_N	119_E	1.579	0.52
56_E	85_K	1.543	0.51
99_W	113_P	1.538	0.50
13_V	127_L	1.536	0.50
101_S	104_E	1.532	0.50
6_I	10_V	1.503	0.49
13_V	82_V	1.503	0.49
89_N	114_N	1.474	0.47
80_V	136_V	1.460	0.47
14_L	79_Y	1.438	0.46
19_V	111_D	1.421	0.45
34_Y	107_F	1.411	0.44
87_K	119_E	1.402	0.44
25_V	84_G	1.375	0.43
6_I	71_D	1.373	0.43
46_T	70_Y	1.329	0.41
40_D	97_K	1.312	0.40
64_V	95_K	1.307	0.39
41_G	66_I	1.285	0.38
27_K	123_E	1.270	0.38
87_K	121_E	1.268	0.38
22_L	81_E	1.258	0.37
25_V	103_L	1.251	0.37
20_G	45_Y	1.219	0.36
28_G	125_I	1.195	0.34
47_P	103_L	1.192	0.34
7_K	126_R	1.192	0.34
50_K	96_D	1.191	0.34
68_L	80_V	1.179	0.34
21_S	66_I	1.163	0.33
109_G	112_D	1.147	0.32
80_V	118_L	1.147	0.32
27_K	104_E	1.141	0.32
58_I	116_V	1.131	0.32
21_S	79_Y	1.118	0.31
84_G	116_V	1.112	0.31
40_D	96_D	1.111	0.31
23_A	96_D	1.111	0.31
37_F	44_I	1.109	0.31
51_E	114_N	1.108	0.31
20_G	44_I	1.091	0.30
36_T	46_T	1.074	0.29
70_Y	81_E	1.071	0.29
57_E	116_V	1.068	0.29
43_T	56_E	1.066	0.29
27_K	39_H	1.041	0.28
55_A	84_G	1.040	0.28
31_H	84_G	1.031	0.28
28_G	60_N	1.023	0.27
34_Y	127_L	1.009	0.27
17_H	64_V	0.999	0.26
108_D	123_E	0.999	0.26
82_V	88_I	0.977	0.26
107_F	128_M	0.973	0.26
106_W	115_L	0.969	0.25
97_K	102_K	0.964	0.25
25_V	133_K	0.963	0.25
56_E	134_T	0.952	0.25
10_V	125_I	0.952	0.25
3_Q	8_Q	0.949	0.25
25_V	28_G	0.943	0.24
34_Y	70_Y	0.933	0.24
65_H	128_M	0.932	0.24
106_W	120_I	0.932	0.24
13_V	93_E	0.928	0.24
87_K	104_E	0.911	0.23
15_D	125_I	0.910	0.23
82_V	96_D	0.894	0.23
74_G	77_D	0.886	0.22
23_A	130_A	0.879	0.22
27_K	49_S	0.877	0.22
94_L	104_E	0.868	0.22
13_V	80_V	0.866	0.22
53_H	83_A	0.859	0.22
126_R	129_N	0.856	0.21
9_K	12_D	0.850	0.21
100_S	103_L	0.849	0.21
26_Q	57_E	0.847	0.21
10_V	104_E	0.847	0.21
34_Y	129_N	0.844	0.21
27_K	66_I	0.835	0.21
37_F	46_T	0.830	0.21
48_T	54_K	0.823	0.20
7_K	51_E	0.815	0.20
50_K	56_E	0.811	0.20
22_L	63_N	0.808	0.20
52_T	126_R	0.804	0.20
13_V	90_N	0.804	0.20
54_K	61_N	0.803	0.20
39_H	125_I	0.795	0.20
73_E	128_M	0.793	0.20
39_H	120_I	0.793	0.20
68_L	124_D	0.786	0.19
50_K	90_N	0.766	0.19
22_L	67_L	0.756	0.18
47_P	134_T	0.751	0.18
14_L	42_L	0.744	0.18
58_I	64_V	0.739	0.18
21_S	44_I	0.737	0.18
6_I	136_V	0.734	0.18
36_T	70_Y	0.731	0.18
77_D	95_K	0.730	0.18
16_H	104_E	0.727	0.18
22_L	82_V	0.723	0.17
98_I	117_I	0.717	0.17
92_A	123_E	0.711	0.17
22_L	37_F	0.701	0.17
19_V	46_T	0.697	0.17
9_K	75_F	0.692	0.17
77_D	118_L	0.686	0.16
15_D	111_D	0.680	0.16
32_S	104_E	0.679	0.16
5_D	53_H	0.672	0.16
57_E	107_F	0.670	0.16
40_D	60_N	0.668	0.16
34_Y	131_G	0.665	0.16
47_P	131_G	0.663	0.16
36_T	118_L	0.657	0.16
11_L	119_E	0.657	0.16
39_H	45_Y	0.656	0.16
47_P	126_R	0.656	0.16
37_F	79_Y	0.650	0.16
90_N	104_E	0.649	0.16
59_E	120_I	0.640	0.15
47_P	55_A	0.636	0.15
98_I	107_F	0.634	0.15
3_Q	80_V	0.630	0.15
68_L	114_N	0.626	0.15
97_K	110_K	0.624	0.15
87_K	136_V	0.616	0.15
77_D	129_N	0.612	0.15
78_A	98_I	0.610	0.15
31_H	126_R	0.607	0.14
20_G	46_T	0.607	0.14
25_V	77_D	0.604	0.14
24_T	65_H	0.603	0.14
55_A	82_V	0.597	0.14
8_Q	15_D	0.593	0.14
53_H	56_E	0.589	0.14
40_D	93_E	0.587	0.14
27_K	108_D	0.583	0.14
47_P	106_W	0.583	0.14
71_D	114_N	0.582	0.14
12_D	82_V	0.579	0.14
14_L	78_A	0.579	0.14
34_Y	117_I	0.577	0.14
34_Y	98_I	0.574	0.14
99_W	109_G	0.572	0.14
12_D	137_S	0.569	0.14
21_S	103_L	0.560	0.13
23_A	32_S	0.560	0.13
37_F	81_E	0.557	0.13
47_P	115_L	0.553	0.13
22_L	66_I	0.551	0.13
12_D	114_N	0.549	0.13
58_I	89_N	0.547	0.13
91_S	121_E	0.546	0.13
50_K	113_P	0.546	0.13
21_S	95_K	0.544	0.13
66_I	117_I	0.535	0.13
20_G	119_E	0.531	0.13
80_V	98_I	0.531	0.13
76_G	120_I	0.529	0.13
10_V	116_V	0.528	0.13
43_T	50_K	0.528	0.13
106_W	113_P	0.526	0.13
25_V	120_I	0.525	0.13
74_G	129_N	0.525	0.13
107_F	129_N	0.525	0.13
93_E	117_I	0.524	0.13
37_F	45_Y	0.524	0.13
18_K	100_S	0.522	0.13
9_K	64_V	0.521	0.13
70_Y	77_D	0.519	0.12
12_D	71_D	0.518	0.12
17_H	131_G	0.510	0.12
68_L	71_D	0.507	0.12
22_L	46_T	0.506	0.12
15_D	119_E	0.505	0.12
95_K	110_K	0.503	0.12
11_L	98_I	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ec6A	2	0.9214	99.9	0.63	Contact Map
3db0A	4	0.9071	99.9	0.662	Contact Map
3u35A	4	0.9714	99.9	0.663	Contact Map
2i02A	2	0.9643	99.8	0.665	Contact Map
2hhzA	2	0.9214	99.8	0.674	Contact Map
3ba3A	2	0.9643	99.8	0.677	Contact Map
2re7A	2	0.9071	99.8	0.679	Contact Map
2fhqA	2	0.9357	99.8	0.681	Contact Map
2qeaA	5	0.9571	99.8	0.682	Contact Map
3dmbA	5	0.9786	99.8	0.682	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.