URE3 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

URE3 - Urease subunit gamma

UniProt:	P75030	Sequences: MKLTPVEQEKLLIFAAGELAKQRKARGVLLNYPEAAAYITCFIMEGARDGKGVAELMEAGRHVLTEKDVMEGVPEMLDSIQVEATFPDGVKLVTVHQPISAEVKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	105 (100)
Sequences:	1011 (330)
Seq/√Len:	33.0

BACSU - URE3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_K	68_D	5.192	1.00
26_R	49_D	4.600	1.00
47_A	84_A	3.410	1.00
18_E	22_Q	2.743	1.00
14_F	18_E	2.495	1.00
14_F	22_Q	2.459	1.00
17_G	41_C	2.429	0.99
61_R	100_S	2.383	0.99
43_I	95_V	2.327	0.99
46_G	56_L	2.224	0.99
39_I	95_V	2.037	0.98
42_F	59_A	1.993	0.98
53_V	57_M	1.952	0.97
66_E	74_P	1.801	0.96
42_F	63_V	1.774	0.96
15_A	18_E	1.721	0.95
38_Y	63_V	1.538	0.91
21_K	41_C	1.493	0.89
59_A	62_H	1.488	0.89
36_A	77_L	1.485	0.89
8_Q	12_L	1.473	0.89
28_V	49_D	1.471	0.89
18_E	21_K	1.461	0.88
58_E	62_H	1.461	0.88
32_Y	36_A	1.452	0.88
14_F	41_C	1.431	0.87
13_I	17_G	1.404	0.86
6_V	10_K	1.309	0.82
32_Y	76_M	1.306	0.82
17_G	38_Y	1.299	0.81
16_A	91_K	1.297	0.81
21_K	42_F	1.281	0.80
81_Q	94_T	1.280	0.80
21_K	38_Y	1.270	0.80
19_L	41_C	1.260	0.79
51_K	59_A	1.233	0.78
72_G	75_E	1.214	0.77
55_E	59_A	1.193	0.75
59_A	63_V	1.175	0.74
66_E	75_E	1.100	0.69
13_I	40_T	1.095	0.69
53_V	96_H	1.092	0.69
57_M	60_G	1.089	0.68
15_A	21_K	1.086	0.68
51_K	55_E	1.041	0.65
52_G	55_E	1.031	0.64
39_I	44_M	0.974	0.60
10_K	85_T	0.971	0.59
18_E	41_C	0.968	0.59
9_E	18_E	0.948	0.58
46_G	49_D	0.941	0.57
53_V	56_L	0.937	0.57
56_L	60_G	0.927	0.56
4_T	55_E	0.925	0.56
64_L	99_I	0.912	0.55
64_L	69_V	0.911	0.55
85_T	90_V	0.908	0.54
35_A	99_I	0.881	0.52
24_K	38_Y	0.877	0.52
46_G	51_K	0.869	0.51
44_M	82_V	0.853	0.50
79_S	94_T	0.840	0.49
6_V	90_V	0.834	0.48
33_P	72_G	0.792	0.45
17_G	21_K	0.791	0.45
72_G	77_L	0.775	0.43
21_K	25_A	0.759	0.42
71_E	87_P	0.757	0.42
22_Q	41_C	0.750	0.41
21_K	65_T	0.749	0.41
29_L	62_H	0.746	0.41
42_F	46_G	0.744	0.41
85_T	91_K	0.744	0.41
42_F	60_G	0.734	0.40
10_K	44_M	0.722	0.39
9_E	79_S	0.719	0.39
6_V	97_Q	0.713	0.38
38_Y	61_R	0.713	0.38
14_F	19_L	0.710	0.38
24_K	67_K	0.706	0.38
58_E	61_R	0.696	0.37
6_V	75_E	0.694	0.37
5_P	14_F	0.689	0.36
33_P	91_K	0.689	0.36
36_A	90_V	0.688	0.36
35_A	39_I	0.687	0.36
18_E	40_T	0.683	0.36
79_S	97_Q	0.682	0.36
26_R	45_E	0.679	0.36
43_I	54_A	0.674	0.35
72_G	91_K	0.673	0.35
47_A	82_V	0.673	0.35
58_E	78_D	0.664	0.35
44_M	84_A	0.664	0.35
72_G	76_M	0.662	0.34
77_L	80_I	0.658	0.34
68_D	91_K	0.656	0.34
47_A	93_V	0.656	0.34
70_M	87_P	0.646	0.33
36_A	40_T	0.645	0.33
56_L	91_K	0.645	0.33
54_A	71_E	0.643	0.33
88_D	91_K	0.640	0.33
2_K	43_I	0.638	0.33
5_P	40_T	0.630	0.32
2_K	73_V	0.621	0.31
3_L	7_E	0.618	0.31
2_K	6_V	0.618	0.31
71_E	74_P	0.611	0.31
57_M	96_H	0.609	0.30
89_G	92_L	0.604	0.30
48_R	88_D	0.603	0.30
12_L	32_Y	0.595	0.30
88_D	96_H	0.593	0.29
61_R	97_Q	0.584	0.29
23_R	31_N	0.581	0.29
35_A	68_D	0.580	0.28
4_T	19_L	0.573	0.28
25_A	38_Y	0.572	0.28
65_T	99_I	0.571	0.28
69_V	83_E	0.568	0.28
23_R	45_E	0.567	0.28
4_T	91_K	0.566	0.28
29_L	97_Q	0.565	0.27
45_E	60_G	0.565	0.27
17_G	22_Q	0.562	0.27
28_V	64_L	0.562	0.27
29_L	65_T	0.557	0.27
24_K	28_V	0.554	0.27
12_L	71_E	0.554	0.27
66_E	94_T	0.552	0.27
1_M	7_E	0.536	0.26
45_E	49_D	0.532	0.25
45_E	88_D	0.532	0.25
2_K	8_Q	0.531	0.25
13_I	18_E	0.529	0.25
77_L	82_V	0.528	0.25
11_L	19_L	0.521	0.25
38_Y	42_F	0.517	0.24
7_E	13_I	0.514	0.24
74_P	99_I	0.512	0.24
49_D	81_Q	0.511	0.24
12_L	90_V	0.508	0.24
26_R	50_G	0.507	0.24
12_L	15_A	0.506	0.24
28_V	51_K	0.503	0.24
33_P	46_G	0.502	0.24
46_G	65_T	0.501	0.23
35_A	76_M	0.500	0.23
2_K	28_V	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gy7A	3	1	100	0.034	Contact Map
2fvhA	2	0.9429	100	0.035	Contact Map
4ac7A	3	0.9524	100	0.042	Contact Map
4furA	3	0.9524	100	0.044	Contact Map
3qgaA	3	1	100	0.046	Contact Map
1e9yA	5	0.9905	100	0.049	Contact Map
1xw8A	2	0.9524	27.8	0.936	Contact Map
2xu2A	4	0.981	19	0.941	Contact Map
4d2uA	3	0.8381	17	0.942	Contact Map
1v6tA	4	0.981	14.9	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.