YVEL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVEL - Putative tyrosine-protein kinase YveL

UniProt:	P71051	Sequences: MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLVDADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (179)
Sequences:	18154 (12045)
Seq/√Len:	900.3

ECOLI - ETK WZC MRP MIND BCSQ
BACSU - YVEL YWQD SALA YLXH SOJ MIND
HALSA - Q9HHZ7 Q9HQY5 Q9HNF1 Q9HQJ7 Q9HHU2 O54573 Q9HHL5 O51969 O51991
SULSO - Q97ZW4 Q97VX7 Q981B3 Q97WA2 Q97YM8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
124_Y	155_F	4.218	1.00
186_L	216_K	4.197	1.00
62_A	159_I	3.799	1.00
69_F	157_L	3.512	1.00
75_K	157_L	3.441	1.00
48_L	178_T	3.145	1.00
78_L	155_F	2.622	1.00
180_G	210_L	2.522	1.00
48_L	162_S	2.503	1.00
46_S	152_Y	2.392	1.00
117_K	124_Y	2.278	1.00
45_R	180_G	2.098	1.00
76_K	156_S	2.051	1.00
104_V	114_T	2.035	1.00
70_A	123_L	2.018	1.00
61_S	213_L	2.014	1.00
187_S	214_L	2.001	1.00
145_G	177_Q	1.981	1.00
63_A	93_F	1.976	1.00
62_A	79_L	1.956	1.00
110_S	113_E	1.947	1.00
75_K	156_S	1.937	1.00
49_V	65_L	1.925	1.00
82_A	160_F	1.923	1.00
63_A	89_I	1.875	1.00
79_L	89_I	1.872	1.00
112_S	154_Q	1.824	1.00
82_A	101_L	1.739	1.00
80_V	160_F	1.720	1.00
46_S	160_F	1.686	1.00
183_L	198_A	1.683	1.00
69_F	159_I	1.666	1.00
57_G	215_N	1.637	1.00
66_A	79_L	1.630	1.00
92_T	190_T	1.618	1.00
95_V	125_V	1.560	1.00
61_S	215_N	1.552	1.00
109_A	114_T	1.533	1.00
66_A	159_I	1.523	1.00
63_A	92_T	1.520	1.00
78_L	151_I	1.511	1.00
199_K	203_E	1.481	1.00
69_F	77_V	1.464	1.00
64_N	67_A	1.421	1.00
180_G	211_G	1.413	1.00
182_V	213_L	1.408	1.00
49_V	182_V	1.344	1.00
70_A	122_N	1.323	1.00
100_G	103_N	1.320	1.00
67_A	71_Q	1.288	1.00
152_Y	179_D	1.272	1.00
59_S	89_I	1.264	1.00
72_Q	75_K	1.260	1.00
104_V	147_L	1.254	1.00
114_T	126_L	1.247	1.00
51_S	56_E	1.238	1.00
116_Q	127_T	1.227	1.00
115_V	124_Y	1.220	1.00
49_V	62_A	1.216	1.00
184_V	215_N	1.198	1.00
145_G	149_S	1.193	1.00
78_L	158_V	1.191	1.00
147_L	151_I	1.176	1.00
187_S	217_K	1.169	1.00
45_R	179_D	1.168	1.00
66_A	123_L	1.164	1.00
93_F	123_L	1.156	1.00
99_T	103_N	1.154	1.00
109_A	113_E	1.143	1.00
99_T	109_A	1.133	1.00
100_G	129_G	1.124	1.00
148_I	160_F	1.124	1.00
51_S	58_K	1.123	1.00
103_N	130_P	1.123	1.00
180_G	208_K	1.097	1.00
111_L	115_V	1.082	1.00
61_S	184_V	1.077	1.00
137_E	141_S	1.070	1.00
46_S	178_T	1.061	1.00
58_K	83_D	1.047	1.00
144_M	147_L	1.044	1.00
113_E	116_Q	1.026	1.00
102_T	106_V	1.024	1.00
191_K	194_T	1.021	1.00
53_V	194_T	1.018	1.00
53_V	56_E	1.015	1.00
76_K	154_Q	1.012	1.00
61_S	65_L	1.009	1.00
59_S	161_D	0.990	1.00
66_A	89_I	0.990	1.00
68_V	72_Q	0.989	1.00
49_V	61_S	0.972	1.00
202_L	207_A	0.968	1.00
46_S	148_I	0.961	1.00
111_L	114_T	0.951	1.00
188_G	191_K	0.946	1.00
185_V	195_V	0.945	1.00
52_S	56_E	0.942	1.00
82_A	144_M	0.938	1.00
146_D	150_E	0.934	1.00
47_I	157_L	0.932	1.00
90_N	127_T	0.932	1.00
111_L	126_L	0.924	1.00
181_S	202_L	0.922	1.00
118_T	121_D	0.911	1.00
103_N	108_N	0.900	1.00
84_L	169_A	0.897	1.00
68_V	71_Q	0.893	1.00
150_E	154_Q	0.880	1.00
139_L	143_A	0.879	1.00
88_T	92_T	0.879	1.00
82_A	173_I	0.877	1.00
165_L	198_A	0.877	1.00
181_S	207_A	0.874	1.00
186_L	189_K	0.850	1.00
112_S	150_E	0.848	1.00
200_D	203_E	0.846	1.00
78_L	115_V	0.843	1.00
77_V	157_L	0.840	1.00
50_T	198_A	0.834	1.00
138_L	141_S	0.829	1.00
50_T	170_D	0.829	1.00
115_V	155_F	0.827	1.00
77_V	159_I	0.826	1.00
138_L	142_K	0.821	1.00
50_T	162_S	0.820	1.00
84_L	102_T	0.816	1.00
99_T	114_T	0.815	1.00
124_Y	127_T	0.814	1.00
185_V	212_A	0.813	1.00
81_D	90_N	0.807	1.00
52_S	183_L	0.802	1.00
137_E	140_S	0.802	1.00
136_A	140_S	0.797	1.00
89_I	92_T	0.796	1.00
103_N	106_V	0.793	1.00
112_S	116_Q	0.789	1.00
149_S	152_Y	0.788	1.00
89_I	125_V	0.781	1.00
74_E	122_N	0.780	1.00
93_F	125_V	0.776	1.00
144_M	148_I	0.773	1.00
83_D	86_K	0.772	1.00
83_D	164_P	0.770	1.00
77_V	156_S	0.765	1.00
90_N	97_N	0.763	1.00
91_Q	193_D	0.762	1.00
59_S	88_T	0.760	1.00
101_L	126_L	0.753	1.00
103_N	107_G	0.735	1.00
104_V	126_L	0.734	1.00
115_V	126_L	0.730	1.00
136_A	141_S	0.715	1.00
147_L	150_E	0.711	1.00
76_K	124_Y	0.711	1.00
143_A	146_D	0.710	1.00
155_F	158_V	0.707	1.00
85_R	167_A	0.704	1.00
162_S	174_L	0.703	1.00
198_A	202_L	0.702	1.00
140_S	143_A	0.700	1.00
46_S	179_D	0.695	1.00
80_V	158_V	0.692	1.00
67_A	120_I	0.692	1.00
197_K	200_D	0.692	1.00
104_V	107_G	0.690	1.00
160_F	178_T	0.689	1.00
47_I	159_I	0.689	1.00
146_D	149_S	0.689	1.00
70_A	77_V	0.687	1.00
139_L	142_K	0.682	1.00
101_L	104_V	0.680	1.00
111_L	151_I	0.677	1.00
183_L	199_K	0.676	1.00
50_T	181_S	0.675	1.00
45_R	157_L	0.672	1.00
67_A	123_L	0.666	1.00
120_I	123_L	0.657	1.00
54_P	167_A	0.656	1.00
204_Q	207_A	0.642	1.00
162_S	173_I	0.641	1.00
172_Q	175_A	0.640	1.00
190_T	195_V	0.639	1.00
175_A	207_A	0.639	1.00
101_L	105_L	0.639	1.00
114_T	118_T	0.634	1.00
136_A	139_L	0.633	1.00
192_T	196_L	0.632	1.00
119_P	124_Y	0.632	1.00
171_A	201_A	0.626	1.00
58_K	161_D	0.624	1.00
111_L	150_E	0.623	1.00
86_K	128_S	0.622	1.00
196_L	199_K	0.622	1.00
85_R	170_D	0.621	1.00
78_L	126_L	0.621	1.00
125_V	130_P	0.620	1.00
126_L	147_L	0.611	1.00
79_L	123_L	0.610	1.00
48_L	181_S	0.609	1.00
49_V	159_I	0.606	1.00
63_A	79_L	0.605	1.00
183_L	209_L	0.603	1.00
137_E	142_K	0.601	1.00
48_L	174_L	0.601	1.00
46_S	158_V	0.600	1.00
168_V	171_A	0.599	1.00
115_V	118_T	0.596	1.00
57_G	161_D	0.594	1.00
214_L	217_K	0.593	1.00
134_N	137_E	0.592	1.00
58_K	164_P	0.590	1.00
88_T	91_Q	0.590	1.00
76_K	155_F	0.589	1.00
162_S	170_D	0.588	1.00
183_L	195_V	0.586	1.00
110_S	150_E	0.580	1.00
169_A	173_I	0.578	1.00
87_P	90_N	0.578	1.00
124_Y	153_E	0.575	1.00
196_L	200_D	0.573	1.00
112_S	115_V	0.572	1.00
56_E	191_K	0.566	1.00
44_L	152_Y	0.565	1.00
81_D	87_P	0.563	1.00
118_T	125_V	0.561	1.00
86_K	129_G	0.558	1.00
59_S	92_T	0.557	1.00
81_D	89_I	0.557	1.00
135_P	140_S	0.556	1.00
142_K	146_D	0.555	1.00
142_K	145_G	0.554	1.00
106_V	109_A	0.554	1.00
151_I	154_Q	0.549	1.00
180_G	209_L	0.548	1.00
172_Q	201_A	0.546	1.00
77_V	123_L	0.545	1.00
116_Q	119_P	0.544	1.00
88_T	194_T	0.540	1.00
99_T	113_E	0.540	1.00
51_S	87_P	0.537	1.00
205_S	209_L	0.536	1.00
53_V	190_T	0.536	1.00
52_S	198_A	0.536	1.00
64_N	68_V	0.536	1.00
79_L	159_I	0.534	1.00
65_L	182_V	0.533	1.00
126_L	151_I	0.533	1.00
86_K	164_P	0.532	1.00
69_F	72_Q	0.529	1.00
91_Q	189_K	0.526	1.00
104_V	111_L	0.526	1.00
47_I	210_L	0.524	1.00
170_D	174_L	0.524	1.00
80_V	126_L	0.523	1.00
89_I	93_F	0.523	1.00
148_I	177_Q	0.521	1.00
185_V	190_T	0.519	1.00
195_V	199_K	0.517	1.00
182_V	211_G	0.515	1.00
52_S	201_A	0.513	1.00
124_Y	154_Q	0.513	1.00
210_L	213_L	0.511	1.00
189_K	193_D	0.511	1.00
45_R	152_Y	0.505	1.00
182_V	210_L	0.505	1.00
82_A	163_P	0.501	1.00
186_L	190_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3la6A	4	0.9824	100	0.143	Contact Map
3cioA	2	0.9956	100	0.149	Contact Map
4jlvA	1	0.9031	100	0.152	Contact Map
4jmpA	1	0.9207	100	0.156	Contact Map
4rz3A	2	0.8018	100	0.283	Contact Map
4pfsA	1	0.7974	100	0.315	Contact Map
3pg5A	2	0.7753	100	0.317	Contact Map
1g3qA	1	0.8018	100	0.329	Contact Map
3ea0A	2	0.815	100	0.331	Contact Map
1hyqA	1	0.793	100	0.334	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.