YWGA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWGA - Uncharacterized protein YwgA

UniProt:	P71046	Sequences: MLKEHAKLMKVFSDSGEIIGRKKLQKMIYIAKKMQFPFYEKYDFHFYGPYSEELTLQIEELCNLGFLHEVKEKKGGYFQYRYSLTETGSAFLDHADLDMPDMKGYIDSVNSRSSRFLELVSTILYFDGLEDEEKKEKVFTIKSKQKYTNEEYDEALQYIEELKQIC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	166 (163)
Sequences:	142 (115)
Seq/√Len:	9.0

BACSU - YWGA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
115_R	151_E	4.094	0.98
127_D	163_K	3.943	0.98
134_K	156_L	3.680	0.97
42_Y	113_S	3.226	0.93
9_M	145_Q	2.736	0.86
31_A	158_Y	2.652	0.84
67_L	130_E	2.583	0.82
73_K	76_G	2.511	0.80
36_F	76_G	2.432	0.78
16_G	31_A	2.375	0.76
12_F	67_L	2.262	0.73
106_I	158_Y	2.214	0.71
99_M	146_K	2.114	0.67
8_L	58_I	2.076	0.66
61_L	125_Y	2.066	0.65
34_M	114_S	2.039	0.64
123_I	156_L	1.985	0.62
11_V	42_Y	1.869	0.57
99_M	151_E	1.861	0.57
16_G	121_S	1.838	0.56
9_M	12_F	1.799	0.54
119_L	147_Y	1.774	0.53
34_M	123_I	1.721	0.51
35_Q	42_Y	1.651	0.48
141_I	156_L	1.650	0.48
32_K	110_N	1.646	0.48
11_V	123_I	1.626	0.47
19_I	151_E	1.621	0.46
4_E	76_G	1.600	0.46
57_Q	62_C	1.573	0.44
102_M	105_Y	1.569	0.44
11_V	158_Y	1.564	0.44
4_E	39_Y	1.544	0.43
4_E	41_K	1.516	0.42
96_D	148_T	1.480	0.40
33_K	127_D	1.460	0.40
8_L	108_S	1.437	0.39
14_D	55_T	1.426	0.38
58_I	135_K	1.426	0.38
4_E	156_L	1.401	0.37
158_Y	162_L	1.391	0.37
32_K	146_K	1.387	0.37
41_K	84_L	1.362	0.36
73_K	112_R	1.354	0.35
149_N	160_E	1.353	0.35
20_G	122_T	1.330	0.34
96_D	132_E	1.321	0.34
55_T	62_C	1.312	0.34
85_T	155_A	1.304	0.33
2_L	66_F	1.296	0.33
28_I	37_P	1.286	0.33
30_I	126_F	1.280	0.32
119_L	142_K	1.269	0.32
108_S	161_E	1.235	0.31
11_V	28_I	1.215	0.30
88_G	91_F	1.190	0.29
18_I	106_I	1.173	0.28
114_S	141_I	1.172	0.28
135_K	149_N	1.147	0.28
93_D	153_D	1.143	0.27
39_Y	94_H	1.127	0.27
98_D	103_K	1.122	0.27
89_S	93_D	1.117	0.27
90_A	108_S	1.116	0.26
90_A	111_S	1.110	0.26
16_G	75_G	1.098	0.26
31_A	123_I	1.097	0.26
32_K	84_L	1.076	0.25
135_K	156_L	1.074	0.25
6_A	127_D	1.067	0.25
36_F	102_M	1.060	0.25
94_H	100_P	1.060	0.25
84_L	97_L	1.055	0.24
20_G	47_Y	1.054	0.24
21_R	80_Y	1.049	0.24
30_I	44_F	1.048	0.24
8_L	113_S	1.044	0.24
21_R	116_F	1.041	0.24
67_L	75_G	1.041	0.24
39_Y	43_D	1.040	0.24
103_K	111_S	1.035	0.24
139_F	143_S	1.034	0.24
115_R	142_K	1.028	0.24
30_I	40_E	1.016	0.23
107_D	157_Q	1.016	0.23
106_I	156_L	1.006	0.23
135_K	153_D	1.004	0.23
108_S	158_Y	0.996	0.23
112_R	154_E	0.996	0.23
129_L	162_L	0.989	0.22
11_V	113_S	0.984	0.22
114_S	120_V	0.979	0.22
66_F	155_A	0.973	0.22
39_Y	64_L	0.958	0.21
8_L	14_D	0.949	0.21
138_V	152_Y	0.945	0.21
119_L	122_T	0.936	0.21
13_S	153_D	0.935	0.21
103_K	157_Q	0.934	0.21
86_E	161_E	0.931	0.21
111_S	130_E	0.921	0.20
27_M	102_M	0.921	0.20
9_M	78_F	0.917	0.20
35_Q	105_Y	0.897	0.20
143_S	146_K	0.885	0.19
44_F	126_F	0.880	0.19
93_D	149_N	0.878	0.19
55_T	123_I	0.869	0.19
86_E	89_S	0.862	0.19
23_K	69_E	0.845	0.18
125_Y	149_N	0.832	0.18
3_K	19_I	0.831	0.18
92_L	147_Y	0.822	0.18
122_T	142_K	0.817	0.18
105_Y	153_D	0.816	0.18
39_Y	163_K	0.816	0.18
47_Y	114_S	0.812	0.18
123_I	146_K	0.807	0.17
18_I	136_E	0.803	0.17
1_M	5_H	0.798	0.17
114_S	121_S	0.793	0.17
80_Y	122_T	0.789	0.17
17_E	110_N	0.788	0.17
116_F	120_V	0.788	0.17
17_E	145_Q	0.784	0.17
157_Q	161_E	0.783	0.17
34_M	109_V	0.773	0.17
146_K	151_E	0.770	0.16
4_E	141_I	0.769	0.16
10_K	43_D	0.768	0.16
69_E	116_F	0.765	0.16
78_F	134_K	0.762	0.16
10_K	14_D	0.762	0.16
14_D	58_I	0.760	0.16
54_L	125_Y	0.757	0.16
146_K	152_Y	0.755	0.16
24_L	137_K	0.754	0.16
125_Y	128_G	0.753	0.16
27_M	65_G	0.751	0.16
21_R	69_E	0.748	0.16
11_V	36_F	0.744	0.16
105_Y	156_L	0.744	0.16
69_E	126_F	0.744	0.16
11_V	114_S	0.742	0.16
16_G	110_N	0.737	0.16
31_A	156_L	0.734	0.16
14_D	123_I	0.733	0.16
17_E	92_L	0.732	0.16
98_D	130_E	0.730	0.16
37_P	134_K	0.720	0.15
35_Q	58_I	0.718	0.15
11_V	14_D	0.715	0.15
131_D	156_L	0.711	0.15
5_H	57_Q	0.709	0.15
136_E	140_T	0.702	0.15
73_K	148_T	0.702	0.15
43_D	47_Y	0.690	0.15
70_V	108_S	0.685	0.15
7_K	150_E	0.683	0.14
30_I	124_L	0.681	0.14
91_F	116_F	0.679	0.14
8_L	90_A	0.674	0.14
93_D	157_Q	0.673	0.14
35_Q	107_D	0.672	0.14
101_D	109_V	0.665	0.14
59_E	126_F	0.661	0.14
31_A	35_Q	0.654	0.14
116_F	137_K	0.654	0.14
30_I	60_E	0.647	0.14
4_E	110_N	0.646	0.14
56_L	63_N	0.646	0.14
119_L	150_E	0.645	0.14
35_Q	102_M	0.644	0.14
34_M	87_T	0.641	0.14
40_E	60_E	0.638	0.14
96_D	104_G	0.637	0.14
10_K	94_H	0.636	0.14
37_P	100_P	0.631	0.13
58_I	95_A	0.630	0.13
29_Y	149_N	0.629	0.13
28_I	64_L	0.628	0.13
77_Y	159_I	0.627	0.13
21_R	38_F	0.626	0.13
135_K	141_I	0.624	0.13
17_E	84_L	0.624	0.13
57_Q	124_L	0.623	0.13
152_Y	160_E	0.623	0.13
3_K	161_E	0.613	0.13
14_D	105_Y	0.610	0.13
5_H	53_E	0.610	0.13
87_T	100_P	0.607	0.13
69_E	88_G	0.607	0.13
2_L	5_H	0.604	0.13
130_E	152_Y	0.604	0.13
103_K	161_E	0.600	0.13
10_K	13_S	0.596	0.13
75_G	149_N	0.595	0.13
68_H	97_L	0.595	0.13
11_V	85_T	0.593	0.13
28_I	100_P	0.584	0.12
47_Y	154_E	0.576	0.12
128_G	161_E	0.566	0.12
19_I	81_R	0.564	0.12
134_K	141_I	0.560	0.12
113_S	146_K	0.557	0.12
58_I	133_E	0.553	0.12
70_V	104_G	0.552	0.12
10_K	35_Q	0.551	0.12
83_S	149_N	0.549	0.12
102_M	109_V	0.545	0.12
134_K	147_Y	0.544	0.12
133_E	150_E	0.544	0.12
131_D	160_E	0.544	0.12
52_E	60_E	0.543	0.12
110_N	150_E	0.543	0.12
30_I	52_E	0.540	0.12
53_E	60_E	0.538	0.12
3_K	154_E	0.537	0.12
11_V	46_F	0.533	0.12
13_S	85_T	0.532	0.12
15_S	106_I	0.529	0.11
89_S	160_E	0.529	0.11
6_A	124_L	0.529	0.11
42_Y	154_E	0.527	0.11
152_Y	163_K	0.526	0.11
123_I	141_I	0.525	0.11
8_L	12_F	0.521	0.11
143_S	148_T	0.519	0.11
74_K	138_V	0.519	0.11
96_D	111_S	0.519	0.11
18_I	43_D	0.516	0.11
29_Y	143_S	0.515	0.11
84_L	147_Y	0.513	0.11
62_C	91_F	0.513	0.11
109_V	114_S	0.513	0.11
133_E	148_T	0.512	0.11
21_R	122_T	0.512	0.11
3_K	111_S	0.511	0.11
89_S	161_E	0.509	0.11
42_Y	152_Y	0.509	0.11
47_Y	122_T	0.504	0.11
104_G	112_R	0.503	0.11
119_L	138_V	0.503	0.11
108_S	132_E	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hqeA	2	0.5542	85.1	0.932	Contact Map
1yg2A	2	0.8012	83.4	0.933	Contact Map
2e1nA	2	0.5964	79.8	0.936	Contact Map
2wteA	2	0.4398	78.3	0.937	Contact Map
2fbiA	2	0.7229	73.8	0.939	Contact Map
2fswA	2	0.506	72.1	0.94	Contact Map
2gxgA	2	0.6807	71.7	0.94	Contact Map
3l9fA	2	0.8193	71.5	0.94	Contact Map
1yyvA	2	0.6325	71.1	0.94	Contact Map
2eshA	2	0.6205	70.4	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.