YWNH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWNH - Putative phosphinothricin acetyltransferase YwnH

UniProt:	P71043	Sequences: MTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (158)
Sequences:	4407 (3318)
Seq/√Len:	263.9

ECOLI - MNAT YHHY RIMI RIML RIMJ YJGM ATDA
BACSU - YWNH PAIA YHFO YOKL YUAI YTMI YOAA YNAD YDAF YJCK YYAR RIMI
HALSA - Q9HSL3 Q9HMZ2 Q9HMI8 Q9HNJ3 Q9HRY6 Q9HMF0 Q9HRY5
SULSO - Y209 Q7LXZ8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_S	133_K	3.101	1.00
138_E	141_L	2.755	1.00
4_R	56_E	2.665	1.00
4_R	10_D	2.540	1.00
137_A	143_P	2.393	1.00
132_E	138_E	2.250	1.00
98_S	134_H	2.113	1.00
57_D	63_A	2.073	1.00
63_A	91_C	2.003	1.00
105_L	116_L	1.946	1.00
53_Y	103_E	1.851	1.00
103_E	106_R	1.844	1.00
66_I	104_A	1.813	1.00
105_L	160_R	1.813	1.00
11_L	43_F	1.789	1.00
68_F	108_A	1.782	1.00
109_P	160_R	1.774	1.00
129_K	132_E	1.773	1.00
114_R	144_G	1.766	1.00
20_S	89_E	1.736	1.00
5_L	107_I	1.733	1.00
55_A	96_V	1.670	1.00
8_H	44_S	1.668	1.00
57_D	94_K	1.652	1.00
87_I	96_V	1.619	1.00
15_V	36_P	1.601	1.00
98_S	102_Q	1.589	1.00
105_L	136_F	1.587	1.00
103_E	107_I	1.579	1.00
13_A	16_A	1.555	1.00
128_L	158_L	1.550	1.00
141_L	156_K	1.544	1.00
56_E	60_G	1.538	1.00
141_L	154_D	1.538	1.00
102_Q	134_H	1.487	1.00
81_A	113_I	1.470	1.00
81_A	116_L	1.467	1.00
12_E	16_A	1.455	1.00
122_G	154_D	1.453	1.00
12_E	36_P	1.447	1.00
19_N	34_V	1.442	1.00
8_H	40_M	1.438	1.00
88_D	91_C	1.416	1.00
23_A	33_P	1.416	1.00
107_I	111_L	1.406	1.00
122_G	156_K	1.400	1.00
107_I	110_N	1.382	1.00
115_S	161_E	1.374	1.00
68_F	81_A	1.365	1.00
61_N	88_D	1.332	1.00
26_M	153_Y	1.331	1.00
143_P	159_G	1.329	1.00
37_E	40_M	1.328	1.00
19_N	23_A	1.321	1.00
91_C	94_K	1.320	1.00
6_A	14_V	1.300	1.00
119_F	155_L	1.293	1.00
20_S	24_S	1.286	1.00
139_W	159_G	1.259	1.00
21_T	25_R	1.256	1.00
36_P	40_M	1.254	1.00
6_A	43_F	1.252	1.00
142_F	157_I	1.238	1.00
83_V	116_L	1.237	1.00
138_E	156_K	1.215	1.00
142_F	145_I	1.197	1.00
11_L	15_V	1.188	1.00
22_I	28_T	1.174	1.00
63_A	96_V	1.168	1.00
17_I	62_V	1.095	1.00
128_L	156_K	1.085	1.00
53_Y	107_I	1.083	1.00
41_E	45_G	1.081	1.00
147_E	152_R	1.072	1.00
144_G	161_E	1.072	1.00
119_F	157_I	1.053	1.00
132_E	158_L	1.050	1.00
125_K	129_K	1.046	1.00
35_T	38_D	1.039	1.00
61_N	90_A	1.033	1.00
64_A	87_I	1.032	1.00
138_E	158_L	1.032	1.00
39_R	42_W	1.030	1.00
3_L	100_L	1.019	1.00
50_R	70_T	1.018	1.00
25_R	149_D	1.014	1.00
120_I	131_F	1.011	1.00
30_D	42_W	1.009	1.00
13_A	88_D	1.005	1.00
144_G	154_D	1.002	1.00
115_S	159_G	0.992	1.00
40_M	44_S	0.989	1.00
118_A	158_L	0.974	1.00
11_L	36_P	0.970	1.00
108_A	116_L	0.967	1.00
15_V	19_N	0.956	1.00
16_A	88_D	0.956	1.00
54_V	62_V	0.955	1.00
46_H	69_E	0.955	1.00
120_I	127_S	0.954	1.00
61_N	91_C	0.937	1.00
106_R	110_N	0.937	1.00
128_L	132_E	0.925	1.00
30_D	74_R	0.920	1.00
57_D	91_C	0.919	1.00
20_S	88_D	0.918	1.00
80_T	145_I	0.913	1.00
57_D	61_N	0.912	1.00
120_I	158_L	0.910	1.00
72_Y	119_F	0.908	1.00
106_R	109_P	0.901	1.00
10_D	56_E	0.900	1.00
41_E	44_S	0.899	1.00
43_F	52_L	0.896	1.00
127_S	131_F	0.892	1.00
66_I	100_L	0.889	1.00
114_R	152_R	0.887	1.00
121_F	153_Y	0.875	1.00
89_E	92_R	0.872	1.00
15_V	39_R	0.871	1.00
83_V	118_A	0.859	1.00
128_L	138_E	0.845	0.99
3_L	99_Y	0.845	0.99
31_T	75_P	0.844	0.99
145_I	155_L	0.843	0.99
24_S	89_E	0.839	0.99
21_T	27_V	0.839	0.99
52_L	67_S	0.834	0.99
75_P	78_N	0.827	0.99
105_L	134_H	0.823	0.99
3_L	53_Y	0.820	0.99
13_A	61_N	0.811	0.99
42_W	52_L	0.802	0.99
99_Y	103_E	0.797	0.99
101_L	134_H	0.795	0.99
26_M	149_D	0.784	0.99
129_K	133_K	0.783	0.99
117_M	159_G	0.780	0.99
102_Q	106_R	0.780	0.99
123_H	153_Y	0.773	0.99
18_Y	28_T	0.765	0.99
55_A	64_A	0.756	0.99
49_S	78_N	0.751	0.99
79_K	147_E	0.750	0.99
80_T	117_M	0.744	0.99
123_H	151_K	0.738	0.99
114_R	161_E	0.735	0.99
6_A	52_L	0.727	0.98
35_T	41_E	0.725	0.98
6_A	11_L	0.724	0.98
147_E	150_G	0.724	0.98
29_A	121_F	0.715	0.98
83_V	101_L	0.712	0.98
55_A	100_L	0.710	0.98
11_L	14_V	0.706	0.98
139_W	143_P	0.703	0.98
118_A	131_F	0.700	0.98
5_L	47_T	0.696	0.98
115_S	145_I	0.690	0.98
18_Y	30_D	0.685	0.98
71_F	117_M	0.684	0.98
87_I	91_C	0.683	0.98
46_H	52_L	0.678	0.98
21_T	92_R	0.673	0.97
34_V	39_R	0.672	0.97
95_G	98_S	0.671	0.97
18_Y	22_I	0.663	0.97
119_F	142_F	0.661	0.97
19_N	33_P	0.660	0.97
79_K	152_R	0.656	0.97
29_A	146_A	0.655	0.97
83_V	131_F	0.650	0.97
18_Y	86_Y	0.648	0.97
6_A	54_V	0.647	0.97
19_N	22_I	0.646	0.97
13_A	17_I	0.645	0.97
137_A	159_G	0.645	0.97
86_Y	127_S	0.643	0.97
93_G	97_G	0.643	0.97
122_G	141_L	0.638	0.97
4_R	54_V	0.635	0.96
43_F	47_T	0.632	0.96
18_Y	74_R	0.631	0.96
85_I	131_F	0.629	0.96
120_I	128_L	0.626	0.96
124_N	128_L	0.622	0.96
25_R	148_M	0.616	0.96
96_V	100_L	0.608	0.95
145_I	159_G	0.606	0.95
117_M	142_F	0.603	0.95
126_P	130_L	0.603	0.95
45_G	48_E	0.601	0.95
38_D	41_E	0.601	0.95
37_E	41_E	0.598	0.95
105_L	130_L	0.598	0.95
99_Y	102_Q	0.594	0.95
8_H	43_F	0.593	0.95
8_H	11_L	0.593	0.95
31_T	78_N	0.590	0.95
32_E	75_P	0.587	0.95
132_E	137_A	0.586	0.94
18_Y	65_W	0.586	0.94
50_R	113_I	0.586	0.94
20_S	92_R	0.586	0.94
70_T	73_G	0.584	0.94
12_E	40_M	0.583	0.94
14_V	52_L	0.579	0.94
21_T	86_Y	0.578	0.94
55_A	63_A	0.576	0.94
144_G	152_R	0.575	0.94
65_W	84_S	0.574	0.94
17_I	65_W	0.573	0.94
26_M	151_K	0.571	0.94
139_W	142_F	0.570	0.94
20_S	23_A	0.569	0.94
125_K	132_E	0.568	0.94
26_M	148_M	0.565	0.93
30_D	34_V	0.560	0.93
115_S	139_W	0.558	0.93
31_T	79_K	0.552	0.93
65_W	86_Y	0.549	0.92
130_L	134_H	0.547	0.92
121_F	155_L	0.544	0.92
17_I	86_Y	0.539	0.92
143_P	154_D	0.538	0.92
28_T	74_R	0.533	0.91
85_I	101_L	0.530	0.91
39_R	43_F	0.527	0.91
34_V	38_D	0.525	0.91
137_A	161_E	0.513	0.90
56_E	59_N	0.512	0.90
39_R	52_L	0.509	0.89
46_H	67_S	0.508	0.89
3_L	103_E	0.505	0.89
68_F	104_A	0.501	0.89
152_R	161_E	0.500	0.88
96_V	99_Y	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2j8mA	2	1	100	0.279	Contact Map
3dr6A	2	0.9939	100	0.282	Contact Map
4j3gA	2	0.9877	100	0.335	Contact Map
4h89A	2	0.9816	100	0.378	Contact Map
4mbuA	2	0.9939	100	0.402	Contact Map
2jlmA	3	1	100	0.403	Contact Map
1vhsA	1	0.9939	100	0.405	Contact Map
4jxqA	2	0.9877	100	0.411	Contact Map
1yr0A	2	0.9877	100	0.414	Contact Map
3w6sA	2	0.9693	100	0.415	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.