DIV4A - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DIV4A - Septum site-determining protein DivIVA

UniProt:	P71021	Sequences: MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	164 (147)
Sequences:	966 (659)
Seq/√Len:	54.4

BACSU - DIV4A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_V	53_L	5.293	1.00
49_K	54_D	4.563	1.00
76_E	80_D	2.848	1.00
133_Q	144_K	2.802	1.00
103_I	107_S	2.747	1.00
42_K	47_E	2.731	1.00
35_D	38_I	2.412	1.00
97_E	101_D	2.342	1.00
95_E	99_N	2.325	1.00
99_N	102_R	2.192	1.00
39_V	43_K	2.059	1.00
101_D	105_N	2.044	1.00
72_L	75_Q	2.012	1.00
15_K	22_E	2.005	1.00
102_R	106_E	1.996	1.00
74_A	78_A	1.934	1.00
43_K	47_E	1.927	1.00
5_P	40_L	1.874	0.99
43_K	46_L	1.817	0.99
82_K	88_E	1.698	0.99
75_Q	79_E	1.688	0.99
90_K	94_R	1.688	0.99
14_T	24_E	1.658	0.99
20_Y	26_N	1.650	0.99
8_I	28_F	1.646	0.99
118_I	121_L	1.601	0.98
17_F	21_D	1.599	0.98
3_L	32_V	1.576	0.98
57_I	60_F	1.538	0.98
105_N	109_S	1.516	0.98
108_L	112_R	1.508	0.97
6_N	9_H	1.505	0.97
106_E	110_K	1.469	0.97
84_N	87_K	1.423	0.96
30_A	33_R	1.363	0.95
120_E	124_Q	1.347	0.95
86_Q	90_K	1.344	0.95
61_A	64_E	1.333	0.95
16_S	21_D	1.330	0.95
11_K	33_R	1.313	0.94
45_E	49_K	1.304	0.94
94_R	97_E	1.288	0.94
26_N	30_A	1.287	0.94
37_E	41_R	1.285	0.94
91_L	95_E	1.274	0.93
87_K	91_L	1.272	0.93
77_A	82_K	1.268	0.93
129_R	139_Q	1.258	0.93
9_H	33_R	1.254	0.93
110_K	113_K	1.252	0.93
105_N	108_L	1.250	0.93
107_S	111_S	1.246	0.93
100_A	107_S	1.246	0.93
141_D	144_K	1.242	0.92
45_E	48_A	1.237	0.92
11_K	31_Q	1.225	0.92
5_P	29_L	1.221	0.92
16_S	22_E	1.175	0.90
78_A	85_S	1.171	0.90
20_Y	30_A	1.169	0.90
13_F	25_V	1.158	0.90
128_F	139_Q	1.156	0.89
92_I	96_A	1.129	0.88
69_K	75_Q	1.124	0.88
93_V	97_E	1.120	0.88
137_E	141_D	1.118	0.88
51_N	57_I	1.105	0.87
24_E	29_L	1.086	0.86
36_Y	40_L	1.083	0.86
8_I	36_Y	1.080	0.86
125_S	129_R	1.079	0.86
79_E	83_R	1.073	0.86
46_L	50_V	1.046	0.84
80_D	84_N	1.040	0.84
42_K	133_Q	1.033	0.83
8_I	37_E	1.028	0.83
21_D	27_E	0.988	0.80
90_K	97_E	0.977	0.80
89_A	93_V	0.969	0.79
13_F	30_A	0.965	0.79
62_N	108_L	0.955	0.78
56_R	61_A	0.948	0.78
60_F	64_E	0.936	0.77
132_F	143_L	0.934	0.77
26_N	33_R	0.919	0.75
67_L	81_V	0.907	0.74
27_E	34_K	0.903	0.74
119_E	122_K	0.901	0.74
76_E	143_L	0.894	0.73
88_E	97_E	0.891	0.73
138_A	142_L	0.882	0.72
89_A	96_A	0.871	0.71
129_R	140_L	0.870	0.71
59_H	68_N	0.870	0.71
125_S	128_F	0.861	0.71
124_Q	128_F	0.860	0.70
64_E	67_L	0.855	0.70
83_R	87_K	0.841	0.69
8_I	23_D	0.831	0.68
137_E	140_L	0.822	0.67
3_L	28_F	0.821	0.67
69_K	72_L	0.819	0.67
3_L	9_H	0.818	0.67
78_A	81_V	0.814	0.66
88_E	91_L	0.814	0.66
70_S	73_V	0.812	0.66
67_L	135_L	0.807	0.66
69_K	85_S	0.806	0.65
49_K	52_E	0.794	0.64
133_Q	137_E	0.792	0.64
67_L	70_S	0.791	0.64
110_K	121_L	0.785	0.63
84_N	88_E	0.785	0.63
42_K	46_L	0.783	0.63
17_F	22_E	0.779	0.63
127_V	131_R	0.773	0.62
118_I	128_F	0.771	0.62
58_G	143_L	0.767	0.62
51_N	55_E	0.754	0.60
81_V	85_S	0.754	0.60
26_N	142_L	0.736	0.58
44_T	47_E	0.734	0.58
5_P	12_T	0.730	0.58
3_L	10_N	0.727	0.57
19_G	25_V	0.725	0.57
38_I	42_K	0.720	0.57
59_H	63_I	0.718	0.57
102_R	105_N	0.715	0.56
104_I	108_L	0.704	0.55
121_L	136_I	0.702	0.55
14_T	21_D	0.698	0.54
108_L	134_M	0.697	0.54
73_V	81_V	0.692	0.54
12_T	15_K	0.692	0.54
67_L	85_S	0.691	0.54
130_T	138_A	0.691	0.54
77_A	81_V	0.690	0.54
98_K	102_R	0.689	0.53
125_S	139_Q	0.687	0.53
123_K	127_V	0.686	0.53
132_F	139_Q	0.678	0.52
21_D	35_D	0.672	0.52
51_N	54_D	0.668	0.51
12_T	33_R	0.663	0.51
73_V	128_F	0.656	0.50
99_N	140_L	0.655	0.50
136_I	139_Q	0.650	0.49
93_V	143_L	0.648	0.49
52_E	61_A	0.644	0.49
9_H	16_S	0.641	0.48
70_S	75_Q	0.636	0.48
68_N	72_L	0.634	0.48
56_R	59_H	0.634	0.48
68_N	81_V	0.634	0.48
20_Y	53_L	0.627	0.47
59_H	81_V	0.626	0.47
42_K	49_K	0.626	0.47
60_F	72_L	0.622	0.46
35_D	41_R	0.622	0.46
48_A	52_E	0.621	0.46
18_R	22_E	0.620	0.46
82_K	86_Q	0.619	0.46
93_V	103_I	0.611	0.45
54_D	58_G	0.610	0.45
131_R	139_Q	0.608	0.45
6_N	31_Q	0.607	0.45
99_N	145_N	0.607	0.45
110_K	144_K	0.604	0.44
5_P	10_N	0.596	0.44
77_A	85_S	0.595	0.43
26_N	34_K	0.594	0.43
6_N	120_E	0.592	0.43
54_D	61_A	0.591	0.43
119_E	139_Q	0.591	0.43
115_A	119_E	0.590	0.43
20_Y	141_D	0.589	0.43
10_N	56_R	0.585	0.42
128_F	143_L	0.585	0.42
41_R	48_A	0.584	0.42
68_N	73_V	0.581	0.42
34_K	37_E	0.578	0.42
66_T	90_K	0.572	0.41
32_V	35_D	0.571	0.41
68_N	77_A	0.570	0.41
15_K	39_V	0.565	0.40
139_Q	142_L	0.565	0.40
62_N	94_R	0.565	0.40
136_I	143_L	0.564	0.40
6_N	12_T	0.559	0.40
99_N	106_E	0.558	0.40
17_F	78_A	0.558	0.40
64_E	70_S	0.552	0.39
83_R	134_M	0.552	0.39
63_I	77_A	0.548	0.39
100_A	104_I	0.545	0.38
111_S	118_I	0.542	0.38
20_Y	67_L	0.542	0.38
28_F	48_A	0.541	0.38
107_S	110_K	0.541	0.38
60_F	66_T	0.535	0.37
64_E	85_S	0.535	0.37
5_P	37_E	0.534	0.37
33_R	36_Y	0.530	0.37
118_I	125_S	0.525	0.36
23_D	42_K	0.525	0.36
3_L	26_N	0.524	0.36
58_G	61_A	0.524	0.36
146_D	149_D	0.523	0.36
3_L	35_D	0.522	0.36
124_Q	142_L	0.522	0.36
3_L	7_D	0.521	0.36
42_K	131_R	0.521	0.36
109_S	113_K	0.518	0.36
59_H	71_I	0.511	0.35
108_L	144_K	0.511	0.35
96_A	100_A	0.506	0.34
93_V	105_N	0.504	0.34
71_I	82_K	0.501	0.34
6_N	37_E	0.501	0.34
112_R	116_M	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wujA	2	0.3049	99.7	0.537	Contact Map
2kk7A	1	0.3171	86.4	0.876	Contact Map
3v6iB	1	0.5488	85.4	0.878	Contact Map
3mq9A	4	0.689	82.5	0.882	Contact Map
2dm9A	2	0.2073	82.3	0.882	Contact Map
1i84S	2	0	66	0.897	Contact Map
3v6iA	1	0.6098	65.4	0.897	Contact Map
2dfsA	2	0.7195	64.1	0.898	Contact Map
4xa6A	2	0.811	51.8	0.906	Contact Map
1l2pA	1	0.3476	51.1	0.906	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.