SPEE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPEE - Polyamine aminopropyl transferase

UniProt:	P70998	Sequences: MSELWYTEKQTKNFGITMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSIAGKLDDPRVDVQVDDGFMHIAKSENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKALKEDGIFVAQTDNPWFTPELITNVQRDVKEIFPITKLYTANIPTYPSGLWTFTIGSKKYDPLAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	276 (241)
Sequences:	3290 (2135)
Seq/√Len:	137.5

ECOLI - SPEE
BACSU - SPEE
SULSO - SPEE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_E	101_K	4.992	1.00
177_A	236_K	4.130	1.00
104_T	150_Y	3.549	1.00
22_K	38_E	3.443	1.00
27_E	111_K	3.341	1.00
110_G	114_E	2.999	1.00
79_H	102_K	2.917	1.00
104_T	135_Q	2.906	1.00
82_V	91_I	2.838	1.00
102_K	133_D	2.766	1.00
113_I	136_V	2.737	1.00
83_V	139_G	2.595	1.00
26_T	33_H	2.543	1.00
176_I	186_F	2.494	1.00
141_M	145_K	2.457	1.00
36_M	115_Y	2.404	1.00
170_K	174_A	2.397	1.00
170_K	209_E	2.370	1.00
38_E	44_N	2.292	1.00
91_I	132_V	2.292	1.00
137_D	145_K	2.280	1.00
21_N	38_E	2.254	1.00
180_L	184_G	2.172	1.00
212_P	236_K	2.149	1.00
144_A	175_G	2.131	1.00
104_T	133_D	2.118	1.00
25_H	111_K	2.013	1.00
28_Q	33_H	2.007	1.00
153_I	180_L	2.000	1.00
183_D	237_K	1.997	1.00
91_I	103_A	1.984	1.00
82_V	94_I	1.975	1.00
147_E	178_K	1.972	1.00
114_E	118_K	1.970	1.00
143_I	175_G	1.958	1.00
111_K	114_E	1.957	1.00
110_G	136_V	1.946	1.00
21_N	40_E	1.911	1.00
29_T	111_K	1.840	1.00
143_I	179_A	1.816	1.00
81_L	150_Y	1.814	1.00
153_I	176_I	1.788	1.00
146_S	179_A	1.769	1.00
117_K	128_D	1.759	1.00
74_H	77_P	1.747	1.00
79_H	181_K	1.741	1.00
95_L	103_A	1.721	1.00
29_T	34_L	1.696	1.00
56_E	122_S	1.682	1.00
80_V	94_I	1.638	1.00
91_I	127_L	1.613	1.00
153_I	179_A	1.601	1.00
190_T	232_T	1.599	1.00
26_T	35_E	1.599	1.00
54_T	87_D	1.581	1.00
103_A	132_V	1.579	1.00
146_S	149_Q	1.571	1.00
79_H	148_N	1.554	1.00
94_I	100_V	1.538	1.00
137_D	141_M	1.494	1.00
140_F	166_N	1.480	1.00
70_P	152_V	1.434	1.00
135_Q	142_H	1.418	1.00
71_L	152_V	1.399	1.00
207_V	234_G	1.393	1.00
106_V	142_H	1.378	1.00
25_H	115_Y	1.355	1.00
155_V	186_F	1.347	1.00
80_V	100_V	1.331	1.00
155_V	172_F	1.321	1.00
19_K	40_E	1.316	1.00
141_M	144_A	1.315	1.00
77_P	99_S	1.310	1.00
36_M	46_L	1.308	1.00
183_D	236_K	1.301	1.00
207_V	232_T	1.289	1.00
79_H	149_Q	1.271	1.00
30_E	110_G	1.263	1.00
81_L	106_V	1.263	1.00
68_H	97_H	1.263	1.00
182_E	236_K	1.222	1.00
83_V	157_S	1.217	1.00
139_G	157_S	1.215	1.00
142_H	150_Y	1.195	1.00
221_I	224_Y	1.182	1.00
175_G	179_A	1.162	0.99
143_I	176_I	1.159	0.99
183_D	238_Y	1.154	0.99
142_H	146_S	1.149	0.99
37_V	47_F	1.148	0.99
165_V	169_T	1.119	0.99
171_G	174_A	1.079	0.99
67_A	154_M	1.054	0.99
105_L	134_V	1.052	0.99
67_A	90_V	1.047	0.99
74_H	152_V	1.044	0.99
125_G	128_D	1.043	0.99
140_F	175_G	1.033	0.99
113_I	134_V	1.027	0.99
182_E	237_K	1.026	0.99
188_A	207_V	1.019	0.99
246_S	249_F	1.018	0.99
204_Q	208_K	1.016	0.98
147_E	179_A	1.015	0.98
140_F	171_G	1.010	0.98
23_T	35_E	1.009	0.98
149_Q	181_K	1.007	0.98
93_E	96_K	1.004	0.98
152_V	185_I	0.999	0.98
81_L	153_I	0.989	0.98
246_S	250_D	0.985	0.98
95_L	132_V	0.970	0.98
71_L	94_I	0.958	0.98
213_I	238_Y	0.952	0.98
80_V	152_V	0.945	0.98
155_V	188_A	0.937	0.97
108_I	138_D	0.936	0.97
85_G	105_L	0.932	0.97
111_K	115_Y	0.922	0.97
213_I	235_S	0.920	0.97
29_T	109_D	0.915	0.97
155_V	176_I	0.910	0.97
127_L	132_V	0.910	0.97
204_Q	214_T	0.909	0.97
71_L	97_H	0.909	0.97
24_L	119_F	0.902	0.97
137_D	142_H	0.898	0.97
54_T	123_I	0.894	0.97
204_Q	232_T	0.891	0.97
95_L	126_K	0.889	0.96
34_L	115_Y	0.886	0.96
235_S	239_D	0.879	0.96
219_A	231_F	0.871	0.96
153_I	184_G	0.869	0.96
56_E	120_L	0.861	0.96
94_I	103_A	0.858	0.96
151_D	181_K	0.854	0.96
95_L	131_R	0.850	0.95
88_G	113_I	0.845	0.95
203_V	206_D	0.844	0.95
81_L	142_H	0.840	0.95
65_M	69_V	0.838	0.95
177_A	212_P	0.837	0.95
79_H	104_T	0.834	0.95
61_V	219_A	0.834	0.95
148_N	182_E	0.833	0.95
146_S	150_Y	0.823	0.95
36_M	120_L	0.822	0.95
242_A	245_D	0.820	0.95
91_I	105_L	0.818	0.94
218_T	228_L	0.818	0.94
200_I	216_L	0.817	0.94
63_H	90_V	0.814	0.94
241_L	244_E	0.811	0.94
245_D	250_D	0.804	0.94
169_T	206_D	0.798	0.94
53_M	62_Y	0.796	0.94
129_D	132_V	0.793	0.93
186_F	234_G	0.790	0.93
69_V	217_Y	0.787	0.93
214_T	234_G	0.787	0.93
74_H	185_I	0.787	0.93
105_L	132_V	0.784	0.93
32_Q	109_D	0.784	0.93
175_G	178_K	0.782	0.93
216_L	230_T	0.775	0.93
201_T	205_R	0.773	0.93
83_V	155_V	0.771	0.92
70_P	185_I	0.771	0.92
244_E	248_F	0.770	0.92
174_A	210_I	0.766	0.92
174_A	178_K	0.765	0.92
66_V	187_V	0.763	0.92
94_I	152_V	0.759	0.92
172_F	176_I	0.758	0.92
148_N	179_A	0.756	0.92
240_P	244_E	0.756	0.92
54_T	120_L	0.755	0.92
39_T	45_M	0.752	0.92
58_D	223_T	0.751	0.91
148_N	181_K	0.750	0.91
66_V	90_V	0.748	0.91
246_S	251_I	0.748	0.91
72_F	97_H	0.746	0.91
60_F	254_K	0.743	0.91
80_V	154_M	0.743	0.91
70_P	217_Y	0.739	0.91
23_T	26_T	0.736	0.91
251_I	254_K	0.736	0.91
81_L	143_I	0.736	0.91
62_Y	156_D	0.734	0.91
39_T	43_G	0.734	0.91
82_V	132_V	0.733	0.90
67_A	71_L	0.732	0.90
25_H	34_L	0.730	0.90
247_R	251_I	0.730	0.90
178_K	182_E	0.725	0.90
116_S	119_F	0.722	0.90
245_D	249_F	0.721	0.90
243_V	247_R	0.721	0.90
221_I	225_P	0.720	0.90
188_A	232_T	0.719	0.90
59_E	92_R	0.718	0.90
120_L	123_I	0.717	0.90
21_N	39_T	0.717	0.90
82_V	85_G	0.713	0.89
170_K	210_I	0.709	0.89
248_F	251_I	0.708	0.89
15_G	19_K	0.708	0.89
85_G	109_D	0.707	0.89
114_E	117_K	0.704	0.89
71_L	100_V	0.702	0.89
45_M	52_V	0.702	0.89
47_F	52_V	0.702	0.89
213_I	239_D	0.702	0.89
160_P	168_F	0.698	0.88
202_N	206_D	0.698	0.88
139_G	155_V	0.697	0.88
162_G	165_V	0.696	0.88
176_I	206_D	0.695	0.88
170_K	206_D	0.694	0.88
106_V	137_D	0.693	0.88
18_M	45_M	0.692	0.88
65_M	217_Y	0.691	0.88
78_E	181_K	0.690	0.88
215_K	239_D	0.687	0.87
248_F	252_E	0.685	0.87
67_A	93_E	0.684	0.87
245_D	248_F	0.683	0.87
23_T	37_V	0.683	0.87
37_V	45_M	0.682	0.87
249_F	253_T	0.681	0.87
60_F	63_H	0.679	0.87
158_T	189_Q	0.674	0.86
64_E	93_E	0.673	0.86
206_D	209_E	0.670	0.86
68_H	93_E	0.669	0.86
91_I	94_I	0.669	0.86
63_H	66_V	0.666	0.86
74_H	78_E	0.663	0.86
94_I	154_M	0.657	0.85
30_E	111_K	0.656	0.85
144_A	171_G	0.655	0.85
51_M	161_V	0.655	0.85
95_L	129_D	0.655	0.85
239_D	242_A	0.654	0.85
27_E	114_E	0.653	0.85
63_H	67_A	0.645	0.84
247_R	250_D	0.645	0.84
30_E	34_L	0.642	0.84
88_G	190_T	0.642	0.84
187_V	217_Y	0.641	0.84
67_A	70_P	0.639	0.83
91_I	126_K	0.639	0.83
190_T	230_T	0.638	0.83
189_Q	229_W	0.637	0.83
149_Q	179_A	0.636	0.83
204_Q	216_L	0.635	0.83
91_I	191_D	0.632	0.83
64_E	68_H	0.631	0.83
121_P	125_G	0.629	0.82
76_N	183_D	0.628	0.82
220_N	228_L	0.626	0.82
65_M	219_A	0.624	0.82
59_E	62_Y	0.623	0.82
220_N	224_Y	0.621	0.82
88_G	127_L	0.620	0.82
219_A	222_P	0.616	0.81
43_G	56_E	0.615	0.81
174_A	177_A	0.613	0.81
53_M	63_H	0.613	0.81
180_L	186_F	0.607	0.80
66_V	230_T	0.607	0.80
54_T	107_D	0.606	0.80
173_Y	203_V	0.606	0.80
29_T	85_G	0.605	0.80
15_G	18_M	0.605	0.80
202_N	205_R	0.604	0.80
100_V	103_A	0.603	0.80
244_E	249_F	0.600	0.79
85_G	88_G	0.599	0.79
241_L	245_D	0.599	0.79
27_E	30_E	0.594	0.79
127_L	134_V	0.594	0.79
70_P	187_V	0.590	0.78
90_V	154_M	0.587	0.78
77_P	185_I	0.587	0.78
87_D	107_D	0.583	0.77
79_H	101_K	0.580	0.77
108_I	139_G	0.580	0.77
69_V	233_I	0.578	0.77
156_D	189_Q	0.576	0.77
71_L	80_V	0.575	0.76
213_I	237_K	0.572	0.76
143_I	172_F	0.572	0.76
200_I	230_T	0.571	0.76
51_M	112_V	0.569	0.76
87_D	90_V	0.567	0.75
122_S	125_G	0.562	0.75
29_T	63_H	0.557	0.74
139_G	167_L	0.557	0.74
147_E	182_E	0.557	0.74
161_V	169_T	0.556	0.74
24_L	38_E	0.554	0.74
29_T	32_Q	0.553	0.74
146_S	209_E	0.552	0.74
63_H	69_V	0.551	0.73
105_L	113_I	0.551	0.73
216_L	232_T	0.551	0.73
219_A	255_Y	0.551	0.73
126_K	129_D	0.549	0.73
116_S	120_L	0.548	0.73
60_F	64_E	0.547	0.73
76_N	99_S	0.547	0.73
53_M	191_D	0.547	0.73
86_G	112_V	0.546	0.73
203_V	207_V	0.546	0.73
70_P	73_T	0.545	0.73
36_M	44_N	0.545	0.73
55_S	58_D	0.542	0.72
176_I	184_G	0.541	0.72
24_L	44_N	0.540	0.72
46_L	62_Y	0.540	0.72
215_K	241_L	0.538	0.72
65_M	68_H	0.537	0.72
54_T	89_G	0.537	0.72
187_V	233_I	0.536	0.71
87_D	105_L	0.535	0.71
85_G	93_E	0.535	0.71
244_E	252_E	0.532	0.71
53_M	155_V	0.531	0.71
222_P	225_P	0.531	0.71
240_P	243_V	0.529	0.70
158_T	168_F	0.528	0.70
87_D	189_Q	0.528	0.70
97_H	100_V	0.527	0.70
214_T	232_T	0.526	0.70
84_G	156_D	0.525	0.70
116_S	121_P	0.525	0.70
59_E	63_H	0.524	0.70
100_V	131_R	0.523	0.70
34_L	111_K	0.520	0.69
158_T	229_W	0.518	0.69
145_K	149_Q	0.517	0.69
29_T	112_V	0.516	0.69
46_L	112_V	0.515	0.68
24_L	112_V	0.514	0.68
155_V	159_E	0.514	0.68
53_M	189_Q	0.511	0.68
193_P	229_W	0.510	0.68
35_E	47_F	0.510	0.68
168_F	189_Q	0.509	0.67
186_F	207_V	0.506	0.67
102_K	135_Q	0.506	0.67
159_E	189_Q	0.506	0.67
220_N	223_T	0.506	0.67
19_K	41_E	0.505	0.67
44_N	122_S	0.502	0.66
108_I	161_V	0.502	0.66
100_V	152_V	0.502	0.66
249_F	252_E	0.502	0.66
107_D	205_R	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1inlA	3	0.9855	100	0.326	Contact Map
2o07A	2	1	100	0.339	Contact Map
1xj5A	4	1	100	0.349	Contact Map
2pt6A	2	0.9928	100	0.35	Contact Map
2i7cA	2	0.9928	100	0.351	Contact Map
1iy9A	3	0.9928	100	0.351	Contact Map
1uirA	4	0.9964	100	0.351	Contact Map
2b2cA	2	0.9167	100	0.355	Contact Map
1mjfA	2	0.9529	100	0.358	Contact Map
2cmgA	2	0.9239	100	0.362	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.009 seconds.