YITW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YITW - MIP18 family protein YitW

UniProt:	P70949	Sequences: MEEALKENIMGALEQVVDPELGVDIVNLGLVYDVDMDEDGLTHITMTLTSMGCPLAPIIVDEVKKALADLPEVKDTEVHIVWNPPWTRDKMSRYAKIALGIQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (95)
Sequences:	1963 (1110)
Seq/√Len:	113.8

ECOLI - PAAD
BACSU - YITW
SULSO - Q97X89 Q7LXS9 Q97YS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_D	27_N	5.230	1.00
33_D	45_T	3.279	1.00
91_M	95_A	3.061	1.00
41_L	75_D	3.017	1.00
45_T	81_V	2.761	1.00
43_H	77_E	2.728	1.00
45_T	79_H	2.567	1.00
64_K	68_A	2.345	1.00
10_M	26_V	2.266	1.00
87_T	90_K	2.206	1.00
36_M	42_T	2.196	1.00
44_I	67_L	2.117	1.00
41_L	74_K	1.996	1.00
92_S	95_A	1.791	1.00
43_H	79_H	1.703	1.00
15_Q	66_A	1.640	1.00
17_V	22_G	1.599	1.00
25_I	31_V	1.569	1.00
8_N	72_E	1.524	1.00
6_K	10_M	1.520	1.00
41_L	77_E	1.505	1.00
37_D	41_L	1.484	1.00
14_E	27_N	1.413	1.00
40_G	74_K	1.373	1.00
16_V	66_A	1.370	1.00
61_D	64_K	1.317	1.00
42_T	67_L	1.253	0.99
68_A	76_T	1.249	0.99
12_A	16_V	1.238	0.99
8_N	11_G	1.233	0.99
14_E	24_D	1.206	0.99
67_L	70_L	1.191	0.99
46_M	63_V	1.165	0.99
9_I	67_L	1.146	0.99
97_I	100_G	1.127	0.99
62_E	66_A	1.107	0.98
32_Y	84_P	1.105	0.98
14_E	94_Y	1.072	0.98
48_L	55_L	1.064	0.98
59_I	62_E	1.033	0.97
32_Y	47_T	1.031	0.97
61_D	65_K	1.028	0.97
60_V	80_I	1.024	0.97
42_T	73_V	1.006	0.97
60_V	64_K	1.002	0.97
81_V	84_P	0.995	0.97
93_R	97_I	0.992	0.97
37_D	43_H	0.943	0.96
23_V	95_A	0.936	0.95
33_D	43_H	0.919	0.95
47_T	84_P	0.914	0.95
7_E	11_G	0.913	0.95
12_A	69_D	0.911	0.95
13_L	63_V	0.909	0.95
32_Y	90_K	0.888	0.94
58_I	62_E	0.881	0.94
9_I	36_M	0.872	0.93
31_V	63_V	0.844	0.92
11_G	14_E	0.817	0.91
46_M	78_V	0.802	0.90
68_A	75_D	0.801	0.90
56_A	100_G	0.789	0.89
63_V	78_V	0.787	0.89
88_R	96_K	0.784	0.89
57_P	62_E	0.776	0.89
23_V	99_L	0.775	0.89
91_M	99_L	0.766	0.88
17_V	21_L	0.764	0.88
58_I	61_D	0.758	0.87
55_L	58_I	0.758	0.87
79_H	83_N	0.751	0.87
48_L	82_W	0.741	0.86
22_G	55_L	0.740	0.86
8_N	36_M	0.726	0.85
26_V	56_A	0.722	0.85
66_A	69_D	0.721	0.85
62_E	65_K	0.712	0.84
23_V	92_S	0.701	0.83
13_L	25_I	0.694	0.82
8_N	71_P	0.694	0.82
94_Y	98_A	0.691	0.82
73_V	76_T	0.685	0.82
25_I	59_I	0.678	0.81
23_V	91_M	0.675	0.81
30_L	48_L	0.675	0.81
12_A	66_A	0.670	0.80
67_L	76_T	0.668	0.80
34_V	50_S	0.655	0.79
9_I	34_V	0.654	0.79
27_N	94_Y	0.652	0.78
40_G	73_V	0.652	0.78
36_M	40_G	0.645	0.78
58_I	82_W	0.638	0.77
95_A	100_G	0.636	0.77
48_L	60_V	0.634	0.76
16_V	52_G	0.633	0.76
89_D	99_L	0.632	0.76
35_D	43_H	0.627	0.76
51_M	93_R	0.625	0.75
44_I	76_T	0.623	0.75
22_G	50_S	0.619	0.75
32_Y	46_M	0.619	0.75
39_D	74_K	0.618	0.75
64_K	77_E	0.612	0.74
50_S	56_A	0.611	0.74
40_G	72_E	0.610	0.74
10_M	34_V	0.610	0.74
26_V	60_V	0.609	0.74
17_V	50_S	0.607	0.73
59_I	88_R	0.605	0.73
50_S	54_P	0.598	0.72
6_K	33_D	0.593	0.72
12_A	70_L	0.590	0.71
34_V	54_P	0.586	0.71
35_D	41_L	0.580	0.70
91_M	100_G	0.574	0.69
56_A	78_V	0.569	0.68
20_E	49_T	0.569	0.68
9_I	44_I	0.568	0.68
12_A	15_Q	0.567	0.68
44_I	63_V	0.560	0.67
48_L	52_G	0.560	0.67
50_S	62_E	0.557	0.67
94_Y	97_I	0.553	0.66
49_T	88_R	0.553	0.66
52_G	61_D	0.553	0.66
30_L	55_L	0.552	0.66
50_S	55_L	0.551	0.66
21_L	24_D	0.550	0.66
35_D	45_T	0.550	0.66
49_T	52_G	0.536	0.64
88_R	97_I	0.526	0.62
35_D	74_K	0.520	0.62
51_M	82_W	0.518	0.61
38_E	77_E	0.518	0.61
26_V	52_G	0.517	0.61
22_G	26_V	0.504	0.59
15_Q	93_R	0.504	0.59
47_T	81_V	0.504	0.59
40_G	70_L	0.502	0.59
28_L	80_I	0.501	0.59
69_D	79_H	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lnoA	1	1	100	0.276	Contact Map
1uwdA	1	0.9902	100	0.292	Contact Map
3cq1A	2	0.9706	100	0.3	Contact Map
3ux2A	2	0.9314	100	0.328	Contact Map
2m5oA	1	0.7941	91.3	0.867	Contact Map
1vehA	1	0.7941	90.2	0.87	Contact Map
1xhjA	1	0.8137	78.2	0.889	Contact Map
2z51A	2	0.9314	74.8	0.893	Contact Map
2ew9A	1	0.5784	50.9	0.908	Contact Map
4f2dA	5	0.9412	50.3	0.908	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.