MRAZ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRAZ - Transcriptional regulator MraZ

UniProt:	P55343	Sequences: MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGLDQCLFGYPMHEWKQIEEKLKALPLTKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELWSKVIWEQYTEEQEDSFAEIAENMIGFDI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (133)
Sequences:	2439 (1654)
Seq/√Len:	143.4

ECOLI - MRAZ
BACSU - MRAZ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_E	117_K	4.023	1.00
98_K	119_I	3.467	1.00
47_E	50_Q	2.978	1.00
32_L	40_L	2.976	1.00
104_V	117_K	2.870	1.00
117_K	121_E	2.569	1.00
16_M	105_V	2.446	1.00
14_G	94_L	2.429	1.00
42_G	114_L	2.412	1.00
32_L	89_I	2.131	1.00
42_G	112_I	2.126	1.00
38_Q	119_I	2.087	1.00
100_E	116_S	2.044	1.00
7_Q	104_V	2.017	1.00
70_R	113_E	1.884	1.00
119_I	122_Q	1.882	1.00
31_V	45_M	1.867	1.00
3_M	52_E	1.854	1.00
9_T	102_E	1.819	1.00
118_V	122_Q	1.758	1.00
91_S	95_N	1.727	1.00
2_F	112_I	1.640	1.00
116_S	119_I	1.588	1.00
77_T	90_A	1.570	1.00
37_D	66_R	1.552	1.00
50_Q	53_E	1.444	1.00
45_M	49_K	1.439	1.00
16_M	103_C	1.425	1.00
73_F	109_S	1.422	1.00
59_P	65_A	1.410	1.00
7_Q	117_K	1.395	1.00
60_L	69_T	1.390	1.00
3_M	78_E	1.365	1.00
29_Q	78_E	1.358	1.00
44_P	47_E	1.349	1.00
47_E	110_N	1.333	1.00
79_C	87_V	1.298	1.00
22_F	112_I	1.295	1.00
41_F	111_R	1.290	1.00
99_L	116_S	1.273	1.00
29_Q	45_M	1.272	1.00
38_Q	96_Y	1.268	1.00
56_K	109_S	1.267	1.00
34_R	75_G	1.255	1.00
43_Y	51_I	1.250	1.00
2_F	22_F	1.250	1.00
121_E	125_E	1.247	1.00
3_M	31_V	1.243	1.00
31_V	76_A	1.236	1.00
74_S	120_W	1.233	1.00
21_K	78_E	1.232	1.00
49_K	53_E	1.213	1.00
94_L	99_L	1.182	1.00
130_S	133_E	1.168	1.00
10_I	99_L	1.168	1.00
5_E	75_G	1.156	1.00
63_K	67_A	1.154	0.99
118_V	121_E	1.134	0.99
122_Q	125_E	1.131	0.99
50_Q	54_K	1.130	0.99
122_Q	126_E	1.127	0.99
9_T	101_K	1.114	0.99
43_Y	48_W	1.110	0.99
32_L	79_C	1.104	0.99
91_S	94_L	1.099	0.99
41_F	72_F	1.086	0.99
53_E	57_A	1.081	0.99
6_Y	22_F	1.069	0.99
79_C	90_A	1.059	0.99
12_A	83_K	1.030	0.99
52_E	109_S	1.025	0.99
18_V	87_V	1.013	0.99
46_H	49_K	1.011	0.99
64_D	67_A	0.965	0.98
17_I	84_Q	0.962	0.98
29_Q	80_E	0.940	0.98
77_T	92_S	0.939	0.98
38_Q	110_N	0.938	0.98
18_V	105_V	0.935	0.98
105_V	112_I	0.931	0.98
35_G	41_F	0.915	0.97
126_E	129_D	0.903	0.97
106_I	120_W	0.903	0.97
10_I	103_C	0.900	0.97
89_I	114_L	0.885	0.97
53_E	56_K	0.871	0.97
4_G	33_T	0.870	0.96
5_E	34_R	0.860	0.96
8_H	105_V	0.856	0.96
32_L	42_G	0.854	0.96
39_C	113_E	0.846	0.96
11_D	15_R	0.835	0.96
70_R	108_V	0.831	0.95
98_K	116_S	0.821	0.95
14_G	99_L	0.819	0.95
8_H	20_A	0.813	0.95
36_L	68_F	0.808	0.95
58_L	65_A	0.798	0.94
2_F	44_P	0.795	0.94
31_V	78_E	0.782	0.94
4_G	76_A	0.778	0.94
12_A	100_E	0.777	0.94
63_K	132_A	0.777	0.94
56_K	110_N	0.766	0.93
68_F	131_F	0.757	0.93
49_K	52_E	0.756	0.93
123_Y	126_E	0.749	0.92
33_T	76_A	0.749	0.92
39_C	115_W	0.739	0.92
71_F	124_T	0.736	0.92
45_M	78_E	0.736	0.92
95_N	98_K	0.735	0.92
2_F	25_G	0.733	0.91
55_L	69_T	0.727	0.91
41_F	108_V	0.721	0.91
17_I	23_R	0.720	0.91
101_K	116_S	0.711	0.90
24_E	27_G	0.704	0.90
68_F	72_F	0.704	0.90
69_T	127_Q	0.693	0.89
62_K	65_A	0.691	0.89
8_H	17_I	0.686	0.88
12_A	88_N	0.685	0.88
50_Q	57_A	0.679	0.88
21_K	77_T	0.675	0.88
55_L	58_L	0.675	0.88
5_E	104_V	0.673	0.87
48_W	70_R	0.671	0.87
27_G	30_F	0.668	0.87
50_Q	56_K	0.667	0.87
70_R	115_W	0.665	0.87
51_I	72_F	0.664	0.87
52_E	55_L	0.658	0.86
67_A	123_Y	0.658	0.86
50_Q	110_N	0.655	0.86
16_M	87_V	0.651	0.86
114_L	121_E	0.649	0.86
35_G	66_R	0.643	0.85
38_Q	98_K	0.638	0.85
96_Y	128_E	0.635	0.84
74_S	106_I	0.629	0.84
23_R	85_G	0.628	0.84
32_L	87_V	0.627	0.84
34_R	96_Y	0.626	0.83
100_E	118_V	0.625	0.83
12_A	101_K	0.623	0.83
30_F	42_G	0.622	0.83
103_C	117_K	0.621	0.83
28_E	46_H	0.620	0.83
69_T	111_R	0.619	0.83
26_L	30_F	0.618	0.83
22_F	105_V	0.615	0.82
95_N	121_E	0.614	0.82
73_F	108_V	0.609	0.82
81_L	87_V	0.606	0.81
24_E	84_Q	0.606	0.81
88_N	94_L	0.606	0.81
56_K	73_F	0.605	0.81
55_L	73_F	0.604	0.81
5_E	120_W	0.599	0.81
61_T	68_F	0.597	0.81
48_W	58_L	0.595	0.80
82_D	86_R	0.594	0.80
48_W	76_A	0.588	0.80
60_L	65_A	0.585	0.79
125_E	128_E	0.584	0.79
34_R	72_F	0.584	0.79
40_L	93_L	0.575	0.78
17_I	20_A	0.575	0.78
42_G	87_V	0.571	0.78
12_A	80_E	0.570	0.77
119_I	123_Y	0.566	0.77
23_R	76_A	0.566	0.77
67_A	126_E	0.564	0.77
34_R	131_F	0.554	0.75
92_S	95_N	0.553	0.75
130_S	134_I	0.548	0.75
66_R	69_T	0.539	0.73
76_A	115_W	0.539	0.73
33_T	48_W	0.536	0.73
47_E	51_I	0.535	0.73
103_C	109_S	0.533	0.73
52_E	73_F	0.531	0.72
74_S	94_L	0.530	0.72
31_V	44_P	0.527	0.72
51_I	60_L	0.522	0.71
55_L	109_S	0.522	0.71
5_E	92_S	0.521	0.71
21_K	107_G	0.519	0.71
20_A	117_K	0.519	0.71
72_F	75_G	0.518	0.70
8_H	40_L	0.515	0.70
33_T	43_Y	0.513	0.70
18_V	42_G	0.512	0.70
22_F	75_G	0.509	0.69
3_M	55_L	0.507	0.69
47_E	54_K	0.507	0.69
75_G	124_T	0.503	0.68
40_L	134_I	0.503	0.68
51_I	54_K	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1n0eA	5	0.958	100	0.049	Contact Map
2glwA	1	0.6364	99.7	0.613	Contact Map
1yfbA	2	0.3287	92.5	0.879	Contact Map
2l66A	2	0.3287	89.4	0.888	Contact Map
2w1tA	2	0.4825	89.1	0.888	Contact Map
1mvfD	1	0.2937	58.6	0.915	Contact Map
2mrnA	2	0.3287	37.2	0.925	Contact Map
4k0mC	1	0.5944	15.6	0.938	Contact Map
3o27A	2	0.3706	15.3	0.938	Contact Map
1t4wA	1	0.4126	14.7	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.