YXEL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXEL - Uncharacterized N-acetyltransferase YxeL

UniProt:	P54951	Sequences: MKPRYRLAVERDAEQLLELTLRAYEPIRKLGIRFAAAHADLDLVLKNIRENACYVMEEDGRIIATITLRMPWGKQPGPYGVPHIWWFAVDPDTGKKGIGTKLLQWLEETILRDTLKVPFVSLGTADKHPWLIEMYERKGYVRSGEQDLGKGHITVYMKKQLRHDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	165 (158)
Sequences:	135 (99)
Seq/√Len:	7.9

BACSU - YXEL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_A	89_V	3.302	0.92
54_Y	110_I	3.291	0.92
13_A	41_L	2.867	0.84
8_A	57_E	2.746	0.82
83_H	152_H	2.491	0.75
65_T	140_Y	2.392	0.71
47_N	85_W	2.318	0.69
14_E	93_T	2.258	0.67
22_R	90_D	2.249	0.66
17_L	21_L	2.214	0.65
48_I	68_L	2.207	0.65
87_F	99_G	2.161	0.63
6_R	57_E	2.080	0.60
18_E	22_R	2.038	0.58
78_P	125_A	1.946	0.55
61_R	92_D	1.827	0.50
58_E	96_K	1.767	0.47
8_A	55_V	1.754	0.47
83_H	123_G	1.734	0.46
32_I	159_K	1.727	0.46
24_Y	36_A	1.680	0.44
73_G	80_G	1.645	0.43
8_A	140_Y	1.630	0.42
16_L	62_I	1.577	0.40
15_Q	104_Q	1.538	0.38
16_L	55_V	1.517	0.38
13_A	88_A	1.495	0.37
24_Y	34_F	1.493	0.37
67_T	151_G	1.472	0.36
123_G	154_T	1.424	0.34
89_V	123_G	1.421	0.34
71_P	116_K	1.419	0.34
78_P	152_H	1.418	0.34
9_V	12_D	1.417	0.34
63_I	93_T	1.412	0.34
25_E	93_T	1.401	0.33
73_G	77_G	1.387	0.33
57_E	65_T	1.358	0.32
81_V	119_F	1.348	0.31
61_R	93_T	1.330	0.31
34_F	152_H	1.319	0.30
77_G	83_H	1.315	0.30
16_L	53_C	1.312	0.30
62_I	90_D	1.310	0.30
74_K	102_L	1.308	0.30
8_A	16_L	1.293	0.29
27_I	134_M	1.281	0.29
8_A	65_T	1.281	0.29
42_D	59_D	1.277	0.29
84_I	151_G	1.274	0.29
55_V	62_I	1.274	0.29
4_R	104_Q	1.273	0.29
7_L	54_Y	1.273	0.29
27_I	37_A	1.269	0.29
24_Y	156_Y	1.253	0.28
102_L	145_E	1.248	0.28
23_A	88_A	1.247	0.28
125_A	154_T	1.240	0.28
78_P	83_H	1.237	0.28
24_Y	64_A	1.232	0.27
34_F	156_Y	1.227	0.27
40_D	43_L	1.213	0.27
10_E	49_R	1.193	0.26
21_L	37_A	1.190	0.26
79_Y	83_H	1.185	0.26
63_I	98_I	1.164	0.25
118_P	125_A	1.156	0.25
41_L	45_L	1.150	0.25
36_A	149_G	1.144	0.25
72_W	116_K	1.134	0.24
57_E	140_Y	1.128	0.24
58_E	110_I	1.127	0.24
19_L	69_R	1.117	0.24
12_D	116_K	1.116	0.24
16_L	111_L	1.113	0.24
70_M	90_D	1.109	0.24
85_W	140_Y	1.108	0.24
121_S	143_S	1.106	0.24
17_L	44_V	1.090	0.23
47_N	140_Y	1.076	0.23
25_E	29_K	1.059	0.22
16_L	57_E	1.052	0.22
62_I	111_L	1.048	0.22
85_W	123_G	1.039	0.22
83_H	154_T	1.038	0.22
76_P	83_H	1.031	0.21
27_I	30_L	1.019	0.21
136_E	146_Q	1.009	0.21
51_N	67_T	1.009	0.21
123_G	143_S	0.997	0.21
19_L	31_G	0.989	0.20
16_L	65_T	0.986	0.20
72_W	123_G	0.978	0.20
71_P	123_G	0.977	0.20
84_I	103_L	0.973	0.20
9_V	29_K	0.962	0.20
64_A	111_L	0.957	0.19
51_N	110_I	0.953	0.19
125_A	151_G	0.948	0.19
44_V	110_I	0.941	0.19
71_P	85_W	0.936	0.19
31_G	123_G	0.936	0.19
54_Y	68_L	0.929	0.19
8_A	12_D	0.928	0.19
69_R	76_P	0.923	0.19
30_L	47_N	0.921	0.19
136_E	142_R	0.913	0.18
71_P	78_P	0.906	0.18
55_V	140_Y	0.883	0.18
81_V	105_W	0.878	0.18
17_L	23_A	0.864	0.17
95_K	138_K	0.862	0.17
79_Y	121_S	0.854	0.17
78_P	154_T	0.852	0.17
28_R	43_L	0.852	0.17
65_T	88_A	0.848	0.17
69_R	85_W	0.846	0.17
57_E	88_A	0.844	0.17
92_D	100_T	0.841	0.17
47_N	53_C	0.837	0.17
67_T	158_K	0.837	0.17
77_G	154_T	0.834	0.17
39_A	103_L	0.830	0.16
158_K	161_L	0.829	0.16
53_C	65_T	0.821	0.16
17_L	41_L	0.820	0.16
99_G	119_F	0.818	0.16
27_I	53_C	0.816	0.16
58_E	98_I	0.810	0.16
40_D	136_E	0.807	0.16
98_I	111_L	0.805	0.16
104_Q	114_T	0.803	0.16
74_K	101_K	0.799	0.16
66_I	103_L	0.797	0.16
96_K	103_L	0.784	0.15
34_F	148_L	0.780	0.15
68_L	103_L	0.777	0.15
119_F	160_Q	0.767	0.15
87_F	107_E	0.767	0.15
10_E	45_L	0.760	0.15
127_K	137_R	0.760	0.15
23_A	99_G	0.758	0.15
91_P	122_L	0.758	0.15
14_E	41_L	0.757	0.15
148_L	154_T	0.754	0.15
36_A	148_L	0.752	0.15
69_R	72_W	0.751	0.15
66_I	84_I	0.749	0.15
5_Y	149_G	0.748	0.15
147_D	152_H	0.744	0.15
86_W	151_G	0.736	0.14
27_I	101_K	0.734	0.14
46_K	160_Q	0.726	0.14
7_L	110_I	0.722	0.14
99_G	151_G	0.721	0.14
11_R	93_T	0.720	0.14
104_Q	109_T	0.716	0.14
11_R	101_K	0.712	0.14
123_G	152_H	0.708	0.14
33_R	154_T	0.704	0.14
77_G	152_H	0.701	0.14
66_I	117_V	0.695	0.14
8_A	88_A	0.692	0.14
52_A	70_M	0.688	0.14
30_L	128_H	0.684	0.13
5_Y	134_M	0.679	0.13
71_P	125_A	0.678	0.13
14_E	54_Y	0.673	0.13
109_T	112_R	0.670	0.13
34_F	146_Q	0.668	0.13
16_L	140_Y	0.665	0.13
70_M	125_A	0.662	0.13
71_P	111_L	0.661	0.13
78_P	148_L	0.658	0.13
19_L	96_K	0.652	0.13
83_H	127_K	0.650	0.13
114_T	127_K	0.649	0.13
71_P	77_G	0.646	0.13
13_A	64_A	0.643	0.13
14_E	45_L	0.641	0.13
39_A	44_V	0.637	0.13
108_E	145_E	0.636	0.13
7_L	59_D	0.634	0.13
84_I	125_A	0.626	0.12
35_A	65_T	0.624	0.12
7_L	102_L	0.623	0.12
36_A	85_W	0.616	0.12
60_G	97_G	0.609	0.12
33_R	146_Q	0.606	0.12
32_I	155_V	0.601	0.12
26_P	151_G	0.601	0.12
109_T	137_R	0.599	0.12
76_P	141_V	0.599	0.12
78_P	123_G	0.598	0.12
37_A	43_L	0.597	0.12
30_L	86_W	0.596	0.12
93_T	113_D	0.593	0.12
36_A	154_T	0.589	0.12
104_Q	108_E	0.584	0.12
69_R	118_P	0.581	0.12
93_T	160_Q	0.576	0.12
66_I	101_K	0.575	0.11
64_A	123_G	0.574	0.11
69_R	123_G	0.572	0.11
133_E	136_E	0.570	0.11
77_G	125_A	0.568	0.11
61_R	90_D	0.567	0.11
32_I	69_R	0.565	0.11
84_I	111_L	0.565	0.11
83_H	121_S	0.561	0.11
7_L	114_T	0.560	0.11
44_V	67_T	0.554	0.11
56_M	143_S	0.552	0.11
52_A	110_I	0.549	0.11
24_Y	154_T	0.547	0.11
90_D	109_T	0.544	0.11
121_S	152_H	0.541	0.11
67_T	148_L	0.541	0.11
14_E	68_L	0.539	0.11
93_T	141_V	0.538	0.11
111_L	116_K	0.533	0.11
4_R	59_D	0.531	0.11
32_I	153_I	0.531	0.11
82_P	118_P	0.530	0.11
42_D	92_D	0.527	0.11
84_I	150_K	0.527	0.11
32_I	71_P	0.526	0.11
95_K	98_I	0.526	0.11
34_F	73_G	0.523	0.11
72_W	78_P	0.518	0.11
23_A	157_M	0.512	0.10
47_N	65_T	0.508	0.10
105_W	143_S	0.508	0.10
77_G	123_G	0.505	0.10
14_E	109_T	0.502	0.10
136_E	141_V	0.501	0.10
18_E	108_E	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pc1A	1	0.9333	99.8	0.747	Contact Map
2fiaA	1	0.9394	99.8	0.753	Contact Map
2oh1A	1	0.9455	99.7	0.757	Contact Map
3h4qA	1	0.8242	99.7	0.772	Contact Map
4zbgA	1	0.8303	99.7	0.772	Contact Map
1gheA	1	0.9333	99.7	0.774	Contact Map
3fixA	2	0.8909	99.7	0.776	Contact Map
3blnA	2	0.8545	99.7	0.776	Contact Map
3kkwA	1	0.9333	99.7	0.776	Contact Map
3efaA	2	0.8667	99.6	0.778	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.