YXEA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YXEA - Uncharacterized protein YxeA

UniProt:	P54940	Sequences: MKKAMAILAVLAAAAVICGLLFFHNDVTDRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKVKAKGKYVETWEEVKFEDMPDSVQSKLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	115 (108)
Sequences:	316 (244)
Seq/√Len:	23.4

BACSU - YXEA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_M	110_V	4.156	1.00
62_G	88_V	3.276	1.00
106_M	111_Q	2.772	0.99
42_V	62_G	2.646	0.99
29_D	92_G	2.590	0.99
64_N	68_K	2.398	0.98
60_L	74_F	2.313	0.97
37_Q	91_K	2.237	0.97
85_Y	101_V	2.137	0.96
55_G	77_G	2.030	0.94
48_G	79_E	1.951	0.93
40_V	70_E	1.868	0.91
87_K	99_E	1.814	0.90
61_D	69_K	1.764	0.89
47_D	82_K	1.737	0.88
38_Q	64_N	1.736	0.88
39_D	87_K	1.734	0.88
72_V	95_V	1.671	0.86
81_R	84_A	1.604	0.84
57_E	88_V	1.592	0.83
60_L	95_V	1.559	0.82
88_V	95_V	1.533	0.81
59_T	71_E	1.519	0.80
62_G	90_A	1.479	0.78
44_I	74_F	1.462	0.77
42_V	99_E	1.444	0.76
59_T	73_T	1.406	0.74
37_Q	89_K	1.402	0.74
40_V	72_V	1.391	0.74
44_I	84_A	1.374	0.73
3_K	6_A	1.359	0.72
36_H	96_E	1.339	0.71
68_K	73_T	1.285	0.67
81_R	100_E	1.282	0.67
44_I	60_L	1.279	0.67
48_G	93_K	1.262	0.66
29_D	96_E	1.249	0.65
89_K	96_E	1.210	0.63
6_A	20_L	1.202	0.62
43_Q	60_L	1.198	0.62
19_G	87_K	1.183	0.61
27_V	37_Q	1.179	0.61
12_A	113_K	1.175	0.60
30_R	92_G	1.170	0.60
72_V	90_A	1.129	0.57
42_V	98_W	1.098	0.55
40_V	90_A	1.090	0.55
42_V	88_V	1.088	0.54
59_T	82_K	1.076	0.54
48_G	84_A	1.067	0.53
55_G	75_F	1.067	0.53
50_H	85_Y	1.061	0.52
74_F	98_W	1.057	0.52
37_Q	96_E	1.034	0.51
52_S	71_E	1.033	0.51
53_P	64_N	1.029	0.50
50_H	98_W	1.017	0.49
39_D	89_K	1.017	0.49
44_I	48_G	1.001	0.48
76_A	81_R	1.001	0.48
8_L	45_D	0.998	0.48
5_M	108_D	0.981	0.47
43_Q	83_N	0.952	0.45
101_V	114_L	0.938	0.44
42_V	60_L	0.933	0.44
52_S	72_V	0.927	0.43
40_V	94_Y	0.914	0.42
7_I	110_V	0.913	0.42
11_L	112_S	0.908	0.42
57_E	73_T	0.903	0.41
74_F	80_L	0.872	0.39
31_F	94_Y	0.869	0.39
47_D	79_E	0.863	0.39
18_C	88_V	0.863	0.39
94_Y	98_W	0.851	0.38
29_D	90_A	0.844	0.38
28_T	64_N	0.841	0.37
61_D	66_S	0.824	0.36
85_Y	106_M	0.823	0.36
79_E	82_K	0.815	0.36
13_A	88_V	0.803	0.35
7_I	10_V	0.802	0.35
18_C	21_L	0.801	0.35
61_D	98_W	0.793	0.34
29_D	94_Y	0.791	0.34
36_H	94_Y	0.790	0.34
54_G	104_E	0.767	0.33
42_V	110_V	0.763	0.32
72_V	88_V	0.755	0.32
18_C	69_K	0.753	0.32
49_R	88_V	0.753	0.32
58_Y	74_F	0.742	0.31
13_A	57_E	0.736	0.31
27_V	99_E	0.729	0.30
60_L	106_M	0.726	0.30
11_L	109_S	0.710	0.29
6_A	114_L	0.707	0.29
3_K	14_A	0.692	0.28
10_V	24_H	0.690	0.28
69_K	73_T	0.690	0.28
43_Q	102_K	0.676	0.27
45_D	108_D	0.674	0.27
57_E	75_F	0.670	0.27
6_A	14_A	0.669	0.27
9_A	13_A	0.656	0.26
23_F	29_D	0.655	0.26
20_L	101_V	0.655	0.26
9_A	64_N	0.649	0.26
84_A	96_E	0.643	0.25
12_A	63_Y	0.632	0.25
91_K	98_W	0.632	0.25
84_A	100_E	0.631	0.25
25_N	28_T	0.630	0.25
7_I	37_Q	0.629	0.25
3_K	48_G	0.626	0.25
21_L	25_N	0.621	0.24
8_L	14_A	0.615	0.24
95_V	103_F	0.615	0.24
36_H	84_A	0.613	0.24
9_A	85_Y	0.613	0.24
84_A	101_V	0.613	0.24
45_D	98_W	0.611	0.24
4_A	10_V	0.608	0.24
22_F	59_T	0.608	0.24
5_M	104_E	0.606	0.24
68_K	112_S	0.603	0.23
7_I	111_Q	0.601	0.23
102_K	105_D	0.600	0.23
45_D	48_G	0.596	0.23
38_Q	56_T	0.594	0.23
44_I	81_R	0.594	0.23
103_F	111_Q	0.587	0.23
29_D	93_K	0.587	0.23
75_F	83_N	0.585	0.22
47_D	62_G	0.580	0.22
37_Q	97_T	0.580	0.22
11_L	14_A	0.580	0.22
12_A	23_F	0.577	0.22
17_I	49_R	0.573	0.22
6_A	108_D	0.573	0.22
44_I	94_Y	0.572	0.22
44_I	70_E	0.559	0.21
21_L	87_K	0.558	0.21
90_A	94_Y	0.555	0.21
19_G	24_H	0.555	0.21
44_I	110_V	0.549	0.21
76_A	95_V	0.542	0.20
10_V	28_T	0.541	0.20
56_T	93_K	0.537	0.20
39_D	104_E	0.533	0.20
43_Q	95_V	0.533	0.20
103_F	112_S	0.526	0.20
41_Y	58_Y	0.525	0.20
36_H	91_K	0.519	0.19
13_A	78_K	0.518	0.19
42_V	100_E	0.516	0.19
87_K	109_S	0.510	0.19
30_R	106_M	0.510	0.19
70_E	94_Y	0.509	0.19
41_Y	44_I	0.507	0.19
104_E	109_S	0.505	0.19
18_C	26_D	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nppA	4	0.7565	100	0.318	Contact Map
2k5qA	1	0.7478	99.9	0.391	Contact Map
2k5wA	1	0.7739	99.9	0.394	Contact Map
4qflA	1	0.7391	46.2	0.909	Contact Map
3j46n	1	0.6696	30.2	0.918	Contact Map
2mmpA	1	0.5478	18.6	0.925	Contact Map
4ff5A	1	0.5913	17.7	0.926	Contact Map
2j5lA	1	0	10.5	0.933	Contact Map
4pj0U	1	0.513	10.5	0.933	Contact Map
3vmtA	1	0.4696	10.1	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.