YQJX - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQJX - Uncharacterized protein YqjX

UniProt:	P54561	Sequences: MNDHLKRGNLLWEGSRMFLPEHKQSLLERKRLKQKLQKPILDPDKLEEMNQTLCAAMEFAQDITVSCFQDGEIVCCTGKICRYEEFEKAVWIKGDEDQLYKLKLDQVLDIVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	112 (101)
Sequences:	247 (205)
Seq/√Len:	20.4

BACSU - YQJX YOLD YOZL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_N	13_E	3.705	1.00
23_K	27_L	3.082	0.99
10_L	13_E	2.954	0.99
7_R	11_L	2.946	0.99
14_G	18_F	2.666	0.98
24_Q	28_E	2.507	0.98
8_G	12_W	2.249	0.95
11_L	23_K	2.104	0.93
18_F	23_K	1.984	0.91
84_E	91_W	1.953	0.90
31_R	63_I	1.894	0.89
12_W	26_L	1.872	0.88
56_A	80_I	1.864	0.88
68_F	71_G	1.847	0.88
24_Q	27_L	1.827	0.87
9_N	14_G	1.775	0.85
7_R	10_L	1.739	0.84
10_L	14_G	1.689	0.82
56_A	91_W	1.565	0.77
7_R	12_W	1.554	0.76
18_F	22_H	1.544	0.76
17_M	22_H	1.540	0.76
9_N	17_M	1.480	0.73
45_K	48_E	1.398	0.68
35_K	71_G	1.367	0.67
88_K	105_D	1.353	0.66
90_V	94_G	1.343	0.65
89_A	101_K	1.343	0.65
36_L	73_I	1.327	0.64
82_R	91_W	1.325	0.64
11_L	27_L	1.319	0.64
58_E	81_C	1.274	0.61
49_M	110_I	1.227	0.58
11_L	14_G	1.218	0.57
57_M	81_C	1.214	0.57
13_E	23_K	1.209	0.57
13_E	18_F	1.197	0.56
27_L	30_K	1.188	0.55
56_A	79_K	1.184	0.55
66_S	73_I	1.172	0.54
10_L	23_K	1.138	0.52
60_A	82_R	1.122	0.51
46_L	50_N	1.112	0.51
17_M	23_K	1.041	0.46
13_E	17_M	1.040	0.46
30_K	34_Q	1.024	0.45
10_L	17_M	1.022	0.45
10_L	18_F	1.015	0.44
41_L	102_L	1.013	0.44
53_L	83_Y	0.984	0.42
38_K	61_Q	0.979	0.42
23_K	26_L	0.979	0.42
13_E	19_L	0.969	0.41
102_L	110_I	0.960	0.41
49_M	85_E	0.947	0.40
7_R	13_E	0.943	0.40
28_E	32_L	0.937	0.39
45_K	79_K	0.937	0.39
91_W	101_K	0.928	0.39
48_E	71_G	0.922	0.38
39_P	108_L	0.915	0.38
56_A	97_D	0.911	0.38
17_M	44_D	0.902	0.37
88_K	98_Q	0.887	0.36
68_F	107_V	0.883	0.36
14_G	17_M	0.877	0.36
46_L	88_K	0.871	0.35
65_V	101_K	0.870	0.35
74_V	102_L	0.870	0.35
53_L	78_G	0.867	0.35
62_D	105_D	0.848	0.34
60_A	83_Y	0.845	0.34
35_K	52_T	0.839	0.33
8_G	11_L	0.819	0.32
50_N	110_I	0.818	0.32
18_F	26_L	0.806	0.31
67_C	102_L	0.803	0.31
45_K	102_L	0.802	0.31
7_R	26_L	0.794	0.31
32_L	35_K	0.784	0.30
61_Q	107_V	0.783	0.30
19_L	44_D	0.772	0.30
54_C	57_M	0.764	0.29
13_E	25_S	0.752	0.28
45_K	109_D	0.752	0.28
35_K	72_E	0.748	0.28
103_K	106_Q	0.747	0.28
76_C	82_R	0.744	0.28
36_L	70_D	0.742	0.28
38_K	105_D	0.739	0.28
22_H	26_L	0.737	0.28
54_C	80_I	0.735	0.28
32_L	53_L	0.734	0.27
48_E	87_E	0.718	0.27
49_M	102_L	0.709	0.26
29_R	33_K	0.706	0.26
80_I	91_W	0.703	0.26
22_H	102_L	0.702	0.26
55_A	58_E	0.693	0.25
10_L	56_A	0.688	0.25
7_R	18_F	0.674	0.24
62_D	77_T	0.669	0.24
68_F	79_K	0.664	0.24
37_Q	80_I	0.657	0.24
55_A	59_F	0.654	0.24
44_D	104_L	0.653	0.23
11_L	18_F	0.652	0.23
31_R	34_Q	0.650	0.23
53_L	79_K	0.650	0.23
13_E	29_R	0.649	0.23
11_L	25_S	0.646	0.23
36_L	71_G	0.635	0.23
85_E	104_L	0.628	0.22
41_L	62_D	0.626	0.22
26_L	56_A	0.618	0.22
77_T	106_Q	0.617	0.22
18_F	27_L	0.612	0.22
32_L	68_F	0.606	0.21
37_Q	53_L	0.606	0.21
56_A	63_I	0.606	0.21
53_L	110_I	0.600	0.21
41_L	110_I	0.596	0.21
47_E	105_D	0.594	0.21
11_L	81_C	0.585	0.20
54_C	83_Y	0.583	0.20
58_E	61_Q	0.575	0.20
60_A	79_K	0.575	0.20
40_I	66_S	0.574	0.20
65_V	73_I	0.572	0.20
30_K	46_L	0.570	0.20
52_T	85_E	0.565	0.20
12_W	43_P	0.563	0.20
46_L	49_M	0.548	0.19
46_L	109_D	0.546	0.19
31_R	40_I	0.544	0.19
44_D	47_E	0.543	0.19
76_C	92_I	0.540	0.19
92_I	102_L	0.537	0.18
51_Q	104_L	0.536	0.18
25_S	29_R	0.536	0.18
87_E	101_K	0.533	0.18
14_G	44_D	0.532	0.18
92_I	99_L	0.532	0.18
42_D	60_A	0.530	0.18
34_Q	87_E	0.526	0.18
13_E	27_L	0.523	0.18
45_K	56_A	0.522	0.18
68_F	108_L	0.521	0.18
90_V	109_D	0.520	0.18
77_T	97_D	0.511	0.17
93_K	100_Y	0.507	0.17
19_L	24_Q	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vw4Q	1	0.4821	11.5	0.934	Contact Map
2be3A	2	0.6786	9.6	0.936	Contact Map
4x9cA	3	0.5179	8.7	0.937	Contact Map
1vj7A	1	0.8304	8.6	0.938	Contact Map
3kdfA	2	0.5625	8.4	0.938	Contact Map
3qr8A	3	0.4375	8.4	0.938	Contact Map
3pqiA	3	0.3393	7.6	0.939	Contact Map
3cswA	4	0.9464	7.3	0.94	Contact Map
2ph0A	2	0.7946	7.2	0.94	Contact Map
3l9dA	1	0.6339	7.1	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.