YQJT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQJT - Uncharacterized protein YqjT

UniProt:	P54557	Sequences: MHHIELYVSDLEASRRFWGWFLKELGYKEYQKWSSGISWKKDRFYLVIVQAKEPFLEPEYHRCRVGLNHLAFHAESKLQVDQMTEKLTAKGYRVLYRDRHPFAGGDGHYAVFCEDPDRIKVELVAPSC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (124)
Sequences:	539 (406)
Seq/√Len:	36.5

BACSU - YQJT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_D	109_Y	3.773	1.00
84_T	100_H	3.533	1.00
76_S	79_Q	3.382	1.00
18_W	121_V	3.007	1.00
80_V	109_Y	2.855	1.00
10_D	13_A	2.829	1.00
15_R	32_K	2.689	1.00
94_V	100_H	2.667	1.00
17_F	116_P	2.612	1.00
15_R	37_I	2.601	1.00
13_A	117_D	2.597	1.00
1_M	4_I	2.442	1.00
96_Y	120_K	2.386	1.00
14_S	115_D	2.220	0.99
84_T	94_V	2.191	0.99
87_L	113_C	1.932	0.98
77_K	81_D	1.905	0.98
4_I	70_L	1.888	0.98
19_G	39_W	1.846	0.97
51_A	65_V	1.831	0.97
115_D	119_I	1.771	0.97
94_V	111_V	1.600	0.94
5_E	36_G	1.564	0.93
87_L	111_V	1.542	0.93
7_Y	68_N	1.462	0.91
29_E	32_K	1.457	0.91
7_Y	112_F	1.423	0.90
29_E	37_I	1.410	0.89
7_Y	51_A	1.391	0.88
5_E	45_Y	1.381	0.88
58_P	64_R	1.381	0.88
1_M	44_F	1.377	0.88
85_E	89_A	1.366	0.87
74_A	123_L	1.333	0.86
49_V	120_K	1.266	0.83
13_A	16_R	1.255	0.83
105_G	120_K	1.254	0.83
79_Q	82_Q	1.226	0.81
99_R	112_F	1.223	0.81
83_M	123_L	1.217	0.81
85_E	88_T	1.204	0.80
24_E	86_K	1.164	0.77
61_H	64_R	1.154	0.77
84_T	111_V	1.147	0.76
88_T	97_R	1.143	0.76
78_L	82_Q	1.108	0.74
36_G	45_Y	1.107	0.74
51_A	56_L	1.078	0.72
96_Y	101_P	1.078	0.72
19_G	29_E	1.074	0.72
95_L	120_K	1.072	0.71
30_Y	40_K	1.072	0.71
80_V	84_T	1.064	0.71
87_L	92_Y	1.062	0.71
33_W	105_G	1.061	0.71
10_D	78_L	1.055	0.70
1_M	72_F	1.041	0.69
82_Q	89_A	1.029	0.68
51_A	55_F	1.028	0.68
86_K	89_A	0.991	0.65
71_A	120_K	0.973	0.64
45_Y	62_R	0.968	0.63
28_K	34_S	0.943	0.61
2_H	105_G	0.941	0.61
67_L	70_L	0.941	0.61
31_Q	38_S	0.934	0.61
55_F	61_H	0.933	0.60
29_E	83_M	0.929	0.60
17_F	115_D	0.923	0.60
5_E	33_W	0.919	0.59
12_E	35_S	0.907	0.58
33_W	47_V	0.903	0.58
14_S	19_G	0.865	0.55
99_R	103_A	0.854	0.54
102_F	108_H	0.852	0.54
96_Y	99_R	0.846	0.53
23_K	70_L	0.816	0.50
80_V	125_A	0.815	0.50
98_D	104_G	0.813	0.50
38_S	47_V	0.807	0.50
55_F	118_R	0.805	0.49
4_I	86_K	0.802	0.49
74_A	80_V	0.799	0.49
95_L	101_P	0.797	0.49
57_E	64_R	0.789	0.48
84_T	102_F	0.779	0.47
48_I	84_T	0.777	0.47
18_W	39_W	0.776	0.47
22_L	27_Y	0.771	0.46
59_E	65_V	0.768	0.46
33_W	68_N	0.764	0.46
32_K	37_I	0.751	0.45
53_E	97_R	0.750	0.45
27_Y	72_F	0.739	0.44
33_W	103_A	0.738	0.44
29_E	64_R	0.734	0.43
68_N	101_P	0.732	0.43
111_V	119_I	0.731	0.43
18_W	23_K	0.728	0.43
20_W	24_E	0.721	0.42
92_Y	113_C	0.718	0.42
33_W	100_H	0.716	0.42
7_Y	120_K	0.716	0.42
84_T	98_D	0.714	0.42
7_Y	49_V	0.712	0.41
75_E	88_T	0.710	0.41
78_L	97_R	0.708	0.41
33_W	45_Y	0.707	0.41
46_L	70_L	0.707	0.41
18_W	115_D	0.705	0.41
30_Y	38_S	0.703	0.41
13_A	115_D	0.699	0.40
76_S	82_Q	0.698	0.40
34_S	59_E	0.695	0.40
24_E	79_Q	0.694	0.40
2_H	125_A	0.692	0.40
6_L	61_H	0.691	0.40
62_R	95_L	0.691	0.40
2_H	110_A	0.683	0.39
82_Q	86_K	0.681	0.39
16_R	85_E	0.675	0.38
1_M	56_L	0.663	0.37
10_D	58_P	0.661	0.37
11_L	34_S	0.656	0.37
17_F	92_Y	0.650	0.36
33_W	36_G	0.645	0.36
77_K	82_Q	0.644	0.36
6_L	34_S	0.642	0.36
46_L	107_G	0.640	0.35
8_V	117_D	0.635	0.35
92_Y	111_V	0.633	0.35
62_R	124_V	0.629	0.35
8_V	32_K	0.628	0.34
9_S	50_Q	0.627	0.34
4_I	56_L	0.623	0.34
33_W	101_P	0.622	0.34
100_H	111_V	0.613	0.33
56_L	82_Q	0.611	0.33
11_L	50_Q	0.611	0.33
75_E	79_Q	0.609	0.33
26_G	106_D	0.608	0.33
71_A	95_L	0.604	0.33
80_V	88_T	0.600	0.32
28_K	42_D	0.600	0.32
85_E	93_R	0.593	0.32
9_S	117_D	0.587	0.31
7_Y	118_R	0.585	0.31
12_E	15_R	0.583	0.31
48_I	65_V	0.580	0.31
42_D	53_E	0.577	0.31
4_I	33_W	0.576	0.30
27_Y	62_R	0.576	0.30
27_Y	73_H	0.572	0.30
61_H	65_V	0.570	0.30
4_I	67_L	0.569	0.30
45_Y	105_G	0.564	0.30
92_Y	99_R	0.561	0.29
82_Q	85_E	0.560	0.29
23_K	78_L	0.559	0.29
62_R	71_A	0.559	0.29
36_G	105_G	0.559	0.29
5_E	49_V	0.557	0.29
6_L	37_I	0.555	0.29
80_V	111_V	0.554	0.29
94_V	109_Y	0.551	0.29
104_G	108_H	0.548	0.28
16_R	76_S	0.546	0.28
21_F	123_L	0.545	0.28
54_P	118_R	0.529	0.27
105_G	125_A	0.528	0.27
6_L	16_R	0.528	0.27
24_E	102_F	0.527	0.27
95_L	114_E	0.526	0.27
88_T	99_R	0.522	0.27
62_R	120_K	0.521	0.27
56_L	61_H	0.521	0.27
12_E	16_R	0.520	0.26
101_P	104_G	0.519	0.26
24_E	108_H	0.518	0.26
101_P	105_G	0.515	0.26
62_R	70_L	0.513	0.26
7_Y	96_Y	0.506	0.26
98_D	102_F	0.506	0.26
16_R	99_R	0.501	0.25
37_I	54_P	0.500	0.25
59_E	82_Q	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ct8A	2	0.9766	99.9	0.542	Contact Map
4z04A	2	0.9375	99.8	0.585	Contact Map
4qb5A	2	0.9531	99.8	0.614	Contact Map
1xqaA	2	0.8359	99.7	0.624	Contact Map
2rk0A	4	0.9297	99.7	0.626	Contact Map
3e5dA	2	0.9141	99.7	0.63	Contact Map
3huhA	2	0.9375	99.7	0.635	Contact Map
3rriA	3	0.9375	99.7	0.637	Contact Map
3ey7A	2	0.9531	99.7	0.637	Contact Map
4mymA	2	0.9531	99.7	0.64	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.